Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9m1 Olfactory Receptor

Gene Symbol Or9m1
Organism Mouse
Family 9
Subfamily m
Pseudo No
Location chr2:87902745-87903674 (-)
Aliases Olfr1154, RP23-24F19.12, MOR173-2, RP23-24F19.12, MOR173-2

Sequence information


Nucleotide sequence

ATGAGTGTGGAGAACAGCACTGTGAAGACTGAATTCTATCTCCTGGGATTTAGTGATCAT
CCAGAGCTCCAGAGTCTCCTATTTGCTGTGTTTTTCTTCATCTACTCCATTACTCTGATG
GGGAATATTGGCATGATCTTATTGATCACAGTCAGTCCTAATTTACACATTCCCATGTAC
TTTTTCCTCTGTATGCTGTCCTTCATAGATGCATGTTACTCTTCTGTCATTGCCCCCAAA
TTACTTGTGGATCTGATTTCTGACAAGAAGGTGATTTCTTACAATGGCTGTGCTACACAG
TTGTATTTTTTCTGCTCTCTGGTTGATACAGAATCTTTCCTTTTGGCTGCCATGGCTTAT
GACAGGTACATTGCAATTTGTAATCCCCTGCTTTATACTGTAATTATGTCCAAAAGAGTC
TGTACTCACCTGGCATTTGGAGCATTCTTGGGTGGAACTATGAGTTCAATAATCCATACT
ACTAATACTTTCCAATTGTCATTCTGCTCCAAAGTAATTAACCATTTCTTTTGTGATATC
TCTCCACTCTTCTCTCTGTCTTGCACTGATACCTATACACATGACATTATACTCGTGGTG
TTTGCAAGTTTGGTGGAAGCTGTCTCTCTTCTTGCTGTTCTGCTCTCTTATATGTATATT
ATAGTGGCCATTCTTAAAACAGGTTCTGCAGAGGGAAGAAAGAAAGGGTTCTCTACTTGT
GCTTCTCACCTGACAGTAGTTACTATTTATCATGGTACTCTGATTTTCATTTATTTGCGT
CCTAGTACAGGCCATTCAATGGATATTGACAAAATGACTTCTGTGTTCTATACATTGATT
ATACCCATGCTAAATCCTTTGATATATAGTCTCAGGAACAAAGACGTCAAATTTGCGTTT
AGGAAAATTATGAGCAAGAAATCATTTTCT


Conceptual translation

MSVENSTVKTEFYLLGFSDHPELQSLLFAVFFFIYSITLMGNIGMILLITVSPNLHIPMY
FFLCMLSFIDACYSSVIAPKLLVDLISDKKVISYNGCATQLYFFCSLVDTESFLLAAMAY
DRYIAICNPLLYTVIMSKRVCTHLAFGAFLGGTMSSIIHTTNTFQLSFCSKVINHFFCDI
SPLFSLSCTDTYTHDIILVVFASLVEAVSLLAVLLSYMYIIVAILKTGSAEGRKKGFSTC
ASHLTVVTIYHGTLIFIYLRPSTGHSMDIDKMTSVFYTLIIPMLNPLIYSLRNKDVKFAF
RKIMSKKSFS