Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9m1b Olfactory Receptor

Gene Symbol Or9m1b
Organism Mouse
Family 9
Subfamily m
Pseudo No
Location chr2:88005820-88006776 (-)
Aliases Olfr1160, RP23-131J21.1, MOR173-1, RP23-131J21.1, MOR173-1

Sequence information


Nucleotide sequence

ATGCAGAAACCAAAATTTCTACAAATAATGAGTGTGGAGAACAGCACTGTGAAGACTGAA
TTCTATCTCCTGGGATTTAGTGATCATCCAGAGCTCCAGAGTCTCCTGTTTGCTGTGTTT
TTCTCCATCTACTCCATTACTCTGATGGGGAATATTGGCATGATCTTATTGATCACAGTC
AGTCCTAATTTACACATTCCCATGTACTTTTTCCTCTGTATGTTATCCTTCATAGATGCA
TGTTACTCTTCTGTCATTGCCCCCAAATTACTTGTGGATCTGATTTCTGACAAGAAGGTG
ATTTCTTACAATGGCTGTGCTACACAGTTGTATTTTTTCTGCTCTCTGGTTGATACAGAA
TCTTTCCTTTTGGCTGCAATGGCTTATGACAGGTACATTGCAATCTGTAACCCCCTGCTT
TATACTGTAATTATGTCCAAGAGAGTCTGTATTCAGTTGGCATTTGGAGCATTCTTGGGT
GGAACTATGAGTTCAATAATCCATACAACTAATACTTTCCAGTTGTCATTCTGCTCCAAA
GTAATTAACCATTTCTTTTGTGATGTCTCTCCACTCTTCTCTCTGTCCTGCTTTGATACC
TACACACATGACATAATATTGGTGGTGTTTGCAAGTTTGGTGGAAGCTCTCTCTCTTCTT
ACTGTTCTCCTCTCCTATATGTATATTATAGTGGCCATTTGTAAAATAGGTTCTGCAGAA
GGAAGGAAGAAAGGGTTCTCTACTTGTGCTTCTCACCTGGCCGTAATCACCATCTATCAT
GGCACCCTGATTTTCATTTATTTGCGTCCTAGTACAGGACATTCAATGAATATTGACAAA
ATGACCTCTGTGTTCTATACATTGATTATACCCATGCTTAATCCCTTGATATATAGTCTC
AGAAACAAAGATGTCAAATTTGCCTTTAGAAAAATTATTAGCAAAAAATTGTTTACT


Conceptual translation

MQKPKFLQIMSVENSTVKTEFYLLGFSDHPELQSLLFAVFFSIYSITLMGNIGMILLITV
SPNLHIPMYFFLCMLSFIDACYSSVIAPKLLVDLISDKKVISYNGCATQLYFFCSLVDTE
SFLLAAMAYDRYIAICNPLLYTVIMSKRVCIQLAFGAFLGGTMSSIIHTTNTFQLSFCSK
VINHFFCDVSPLFSLSCFDTYTHDIILVVFASLVEALSLLTVLLSYMYIIVAICKIGSAE
GRKKGFSTCASHLAVITIYHGTLIFIYLRPSTGHSMNIDKMTSVFYTLIIPMLNPLIYSL
RNKDVKFAFRKIISKKLFT