Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9m1b Olfactory Receptor

Gene Symbol Or9m1b
Organism Rat
Family 9
Subfamily m
Pseudo No
Location chr3:76237607-76238545 (+)
Aliases Olr606, Olr606

Sequence information


Nucleotide sequence

ATGAGCTTGGAGAACAACACTGTGAAGACTGAATTCCTTCTCTTGGGATTCAGTGATCAT
CCAGAACTACAGAGTCTTCTATTTGTTGTGTTTTTCTCCATCTACTCTGTTACTCTGATG
GGGAATATTGGGATGATCTTATTAATCACAGTCAGTTCTAATTTACATATCCCCATGTAC
TTTTTCCTCTGTATTCTGTCCTTCATAGATGCATGCTACTCTTCTGTCATTGCCCCTAAA
TTACTTGTGAATCTGATTTCTGACAAGAAGGTAATTTCTTACAATGGCTGTGCTACACAG
TTGTACTTTTTCTGCTCTCTGGTTGACACAGAATCTTTCCTTTTGTCTGCCATGTCTTAT
GACAGGTACATTGCAATCTGTAACCCCCTGCTCTATACTGTAATTATGTCCAAGAGAGTC
TGTATTCAGCTAGCATTTGGTGCATTCTTAGGTGGAACTATGAGTTCAATAATCCATACT
ACTAATACATTCCAGTTGTCATTTTGTTCCAAAGAAATTAACCATTTCTTTTGTGATATC
TCTCCACTCTTCTCTCTGTCATGCTCTGATACCTATACACATGATATAATATTGGTAGTA
TTTGCAAGTTTGGTGGAAGCTCTCTCTCTTCTTACTGTTCTCCTCTCCTATATGTATATC
ATAGTGGCCATTTTTAAAATAGGTTCTGCAGAGGGAAGAAAGAAAGGGTTCTCTACTTGT
GCTTCTCACCTGACAGTAATCACCATTTATCATGGCACCCTGATTTTCATTTATTTGCGT
CCTAGTACAGGACATTCAATGGATATTGACAAAATGGCCTCTGTGTTCTATACATTGATT
ATACCCATGCTTAACCCCTTGATATACAGCCTCAGAAACAAAGATGTCAAATTTGCCTTT
AGAAAAATTATTAGCAAAAAAATTGTTTTCTTAACTAAG


Conceptual translation

MSLENNTVKTEFLLLGFSDHPELQSLLFVVFFSIYSVTLMGNIGMILLITVSSNLHIPMY
FFLCILSFIDACYSSVIAPKLLVNLISDKKVISYNGCATQLYFFCSLVDTESFLLSAMSY
DRYIAICNPLLYTVIMSKRVCIQLAFGAFLGGTMSSIIHTTNTFQLSFCSKEINHFFCDI
SPLFSLSCSDTYTHDIILVVFASLVEALSLLTVLLSYMYIIVAIFKIGSAEGRKKGFSTC
ASHLTVITIYHGTLIFIYLRPSTGHSMDIDKMASVFYTLIIPMLNPLIYSLRNKDVKFAF
RKIISKKIVFLTK