Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9m2 Olfactory Receptor

Gene Symbol Or9m2
Organism Mouse
Family 9
Subfamily m
Pseudo No
Location chr2:87990113-87991051 (+)
Aliases Olfr1158, RP23-24C12.2, MOR173-3, RP23-24C12.2, MOR173-3

Sequence information


Nucleotide sequence

ATGAGTGTGGAGAACAGCACTGTGAAGACTGAATTCTATCTCCTGGGATTCAGTGATCAT
CCAGAGCTCCAGAGTCTCCTATTTGCTGTGTTTTTCTCCATCTACTCCATTACTCTGATG
GGGAATATTGGCATGATTGTATTGATCACAGTCAGTCCTAATTTACACATTCCCATGTAC
TTTTTCCTCTGGATGCTGTCCTTCATAGATGCATGTTCCTCCTCTGTCATTGCCCCCAAA
TTACTTGTGGATTTGATTTCTGACAAGAAGGTGATTTCTTACAATGGCTGTGCTACACAG
TTTTATTTTTGCTGCTCTCTGGTTGATACAGAATCTTTCCTGTTGGCTGCCATGGCTTAT
GACAGGTACATTGCAATCTGTAACCCCCTGCTCTATACTGTAATTATGTCCAAGAGGGTC
TGTACTCAGCTGGCATTTGAAGCATTCTTGGGTGGAACTATGAGTTCAATAATCCATACA
ACTAACACTTTCCAGTTGTCATTCTGCTCCAAAGAAATTAACCATTTCTTTTGTGATATG
ACTCCACTCTTCTCTCTGTCCTGCTTTGATACTTACACACATGACATTATACTGGTGTTT
TTCACAAGTTTGGTGGAAGCTGTCTGTCTTCTTGCTGTTCTCCTCTCCTATATGTATATT
ATAGTGGCCATTCTTAAAACAGGTTCTGCAGAGGGAAGAAAGAAAGGGTTCTCTACTTGT
GCTTCTCACCTGGCAGTAATCACCATTTATCATGGCACCCTGATTTTTATTTATTTGTGT
CCTAGTACAGGCCATTCAATGGATATTGACAAAATGACCTCTGTGTTCTATACATTGATT
ATACCCATGCTTAACCCCTTGATATACAGTCTCAGGAACAAAAATGTCAAATTCGCCTTT
AGAAAAATTATTAGCAAAAAATTGTTTTTTTTAGTTATT


Conceptual translation

MSVENSTVKTEFYLLGFSDHPELQSLLFAVFFSIYSITLMGNIGMIVLITVSPNLHIPMY
FFLWMLSFIDACSSSVIAPKLLVDLISDKKVISYNGCATQFYFCCSLVDTESFLLAAMAY
DRYIAICNPLLYTVIMSKRVCTQLAFEAFLGGTMSSIIHTTNTFQLSFCSKEINHFFCDM
TPLFSLSCFDTYTHDIILVFFTSLVEAVCLLAVLLSYMYIIVAILKTGSAEGRKKGFSTC
ASHLAVITIYHGTLIFIYLCPSTGHSMDIDKMTSVFYTLIIPMLNPLIYSLRNKNVKFAF
RKIISKKLFFLVI