Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9q2 Olfactory Receptor

Gene Symbol Or9q2
Organism Mouse
Family 9
Subfamily q
Pseudo No
Location chr19:13794668-13795609 (-)
Aliases Olfr1497, MOR212-1, MOR212-1

Sequence information


Nucleotide sequence

ATGGCTGGGAGGAATTACACCTTCGTGACTGAGTTCTTTCTGACTGCATTCACTGAACAT
CCTGAGTGGGGGCTCCCTCTCTTCCTTTTATTTTTGAGTTTCTACCTCGCTACCCTGCTG
GGGAATACAGGAATGATCATTCTAATCCAGAAGAACCGCCGACTTCAAACACCAATGTAC
TTCTTCCTCAGCCACCTTTCCTTTGTGGACATCTGCTACTCCTCTGTCATCATCCCTCAG
ATGCTGGCTGTGCTGTGGGAACATGGCTCAACCATTTCTCAAGTTCGCTGTGCAGTTCAA
TTCTTCCTCTTTACCTTCTTTGCTTCTATTGACTGCTACCTCTTGGCAATCATGGCCTAC
GACCGCTATGTGGCTGTGTGCCAACCATTGCTTTATGTCACCATCATGACTGAGAAGGCC
CGTGTAGGTCTGGTAACTGGGGCATATGTGGCTGGTTTTTCCAGTGGCTTTATTCGGACT
GTCACAGCCTTCACTCTTTCATTCTGTGGAAACAATGAGATCAATTTCATATTCTGTGAC
CTCCCCCCATTGTTAAAACTCGTATGTGGGGACAGCTACATTCAAGAGGTGGTGATAATT
GTTTTTGCCATTTTTGTCATGCCTGCTTGCATTGTGGTGATCTCTGTGTCCTATCTGTTT
ATCATTGTGGCCATTATGCAAATCCGCTCAGCTGGAGGCCGAGCCAAAACTTTCTCTACC
TGCACCTCCCACCTCACTGCTGTAGCTCTCTTCTTTGGTACTCTTATCTTCATGTACTTG
AGAGATAATACAGATCAGTTCTCGGAGAGGGACAGAGTTGTGTCTGTGTTCTATACAGTG
GTGACCCCATTACTGAATCCACTCATCTATAGCCTGAGAAATAAAGAGGTAAAAGAGGCA
ATTACGAAATCTCTGAGAAGATCAAAGATTTCCAGGGCACCC


Conceptual translation

MAGRNYTFVTEFFLTAFTEHPEWGLPLFLLFLSFYLATLLGNTGMIILIQKNRRLQTPMY
FFLSHLSFVDICYSSVIIPQMLAVLWEHGSTISQVRCAVQFFLFTFFASIDCYLLAIMAY
DRYVAVCQPLLYVTIMTEKARVGLVTGAYVAGFSSGFIRTVTAFTLSFCGNNEINFIFCD
LPPLLKLVCGDSYIQEVVIIVFAIFVMPACIVVISVSYLFIIVAIMQIRSAGGRAKTFST
CTSHLTAVALFFGTLIFMYLRDNTDQFSERDRVVSVFYTVVTPLLNPLIYSLRNKEVKEA
ITKSLRRSKISRAP