Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10A2 Olfactory Receptor

Gene Symbol OR10A21 (View this gene in GeneCards)
Family 10
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR11-86, OST363, HsOR11.4.5
External Ids HGNC: 8161   GeneBank: AF399490, BK004293, NM_001004460   
Build #39 labels OR10A2P
Chromosomal location 11:6,869,755-6,870,663 (+)
Cluster 11@7
Synteny CLIC#24
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10A5 95.71% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10A5 94% 302
Dog OR10A5F 94% 303
Dog OR10A5D 93% 303
Dog OR10A5E 93% 303
Chimp CONTIG*********** 96% 303
Chimp CONTIG784.10-247 97% 226
Mouse Or10a5 92% 302
Mouse Or10a2 90% 302
Rat Or10a5 91% 302
Rat Or10a5b 91% 302
Rat Or10a2 88% 302
Rat Or10a5c-ps 86% 302
Cow OR10U1 55% 295

Sequence information

Nucleotide sequence ATGAGCTTCTCTTCCCTGCCTACTGAAATACAGTCATTACTCTTTCTGACATTTCTAACC
ATCTACCTGGTCACCCTGATGGGAAACTGCCTCATCATTCTGGTTACCCTAGCTGACCCC
ATGCTACACAGCCCCATGTACTTCTTCCTCAGAAACTTATCTTTCCTGGAGATTGGCTTC
AACCTAGTCATTGTGCCCAAAATGCTGGGGACCCTGCTTGCCCAGGACACAACCATCTCC
TTCCTTGGCTGTGCCACTCAGATGTATTTCTTCTTCTTCTTTGGAGTGGCTGAATGCTTC
CTCCTGGCTACCATGGCATATGACCGCTATGTGGCCATCTGCAGTCCCTTGCACTACCCA
GTCATCATGAACCAAAGGACTCGTGCCAAACTGGCTGCTGCCTCCTGGTTCCCAGGCTTT
CCTGTAGCTACTGTGCAGACCACATGGCTCTTCAGTTTTCCATTCTGTGGCACCAACAAG
GTGAACCACTTCTTCTGTGACAGCCCACCTGTGCTGAGGCTGGTCTGTGCAGACACAGCA
CTCTTTGAGATCTACGCCATCGTCGGAACCATTCTGGTGGTCATGATCCCCTGCTTGCTG
ATCTTGTGTTCCTATACTCACATTGCTGCTGCCATCCTCAAGATCCCATCAGCTAAAGGG
AAGAATAAAGCCTTTTCTACATGTTCCTCACACCTCCTTGTTGTCTCTCTTTTCTATATA
TCATTAAGCCTCACCTACTTCCGGCCTAAATCAAATAATTCACCTGAGGGCAAGAAGCTG
CTATCATTGTCCTACACTGTTATGACTCCCATGTTGAACCCCATTATCTACAGCCTGAGA
AATAACGAGGTGAAGAATGCCCTCAGCAGGACGGTCTCTAAGGCCCTAGCCCTCAGAAAC
TGTATCCCA
Conceptual translation MSFSSLPTEIQSLLFLTFLTIYLVTLMGNCLIILVTLADPMLHSPMYFFLRNLSFLEIGF
NLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMAYDRYVAICSPLHYP
VIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLRLVCADTA
LFEIYAIVGTILVVMIPCLLILCSYTHIAAAILKIPSAKGKNKAFSTCSSHLLVVSLFYI
SLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSLRNNEVKNALSRTVSKALALRN
CIP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 6,891,758 6,891,758 NS A/C K/T rs7926083 (DbSNP)
11 6,891,113 6,891,113 NS A/G H/R rs3930075 (DbSNP)
11 6,891,605 6,891,605 NS A/G H/R rs10839631 (DbSNP)
11 6,891,704 6,891,704 NS C/T T/I rs10839632 (DbSNP)
11 6,891,385 6,891,385 NS G/A A/T rs2741764 (DbSNP)
11 6,891,419 6,891,419 NS G/T G/V rs11603197 (DbSNP)
11 6,891,528 6,891,528 SYN C/G L/L rs7117739 (DbSNP)
11 6,891,540 6,891,540 SYN C/T Y/Y rs7117744 (DbSNP)
11 6,891,618 6,891,618 SYN C/T A/A rs61737577 (DbSNP)
11 6,870,297 6,870,297 SYN C/G L/L 1000GP (CEU, CHBJPT)
11 6,870,374 6,870,374 NS A/G H/R 1000GP (CEU, CHBJPT)
11 6,870,154 6,870,154 NS G/A A/T 1000GP (CEU, CHBJPT)
11 6,870,473 6,870,473 NS T/C I/T 1000GP (CEU, CHBJPT)
11 6,870,527 6,870,527 NS A/C K/T 1000GP (CEU, CHBJPT)
11 100 -100 NS G/A A/T 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN C/G L/L 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10A2.aApr07-unspliced main_exon CDS chr11 6,869,755 6,870,663 +
3UTR chr11 6,870,663 6,870,666 +