Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10A6 Olfactory Receptor

Gene Symbol OR10A61 (View this gene in GeneCards)
Family 10
Subfamily A
Pseudogene No
CORP pseudogene probability score
Aliases OR11-96, HsOR11.5.7, ORL3414
External Ids HGNC: 15132   GeneBank: AB065515, AB065588, BK004403, NM_001004461   ORDB: ORL3414   
Build #39 labels OR10A6
Chromosomal location 11:7,927,721-7,928,662 (-)
Cluster 11@8
Synteny CLIC#25
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs4758258)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10A3 85.3% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10A6 87% 313
Chimp CONTIG674.105-4796 98% 314
Mouse Or10a3 79% 309
Rat Or10a49 79% 313
Cow OR10U1 50% 303

Expression evidences

Source Accession
ESTs BQ012254
mRNA AB529270
GNF Atlas2 gnf1h05429_at

Sequence information

Nucleotide sequence ATGGAAAGACAAAATCAAAGCTGTGTGGTTGAATTCATCCTCTTGGGCTTTTCTAACTAT
CCTGAGCTCCAGGGGCAGCTCTTTGTGGCTTTCCTGGTTATTTATCTGGTGACCCTGATA
GGAAATGCCATTATTATAGTCATCGTCTCCCTAGACCAGAGCCTCCACGTTCCCATGTAC
CTGTTTCTCCTGAACTTATCTGTGGTGGACCTGAGTTTCAGTGCAGTTATTATGCCTGAA
ATGCTGGTGGTCCTCTCTACTGAAAAAACTACAATTTCTTTTGGGGGCTGTTTTGCACAG
ATGTATTTCATCCTTCTTTTTGGTGGGGCTGAATGTTTTCTTCTGGGAGCAATGGCTTAT
GACCGATTTGCTGCAATTTGCCATCCTCTCAACTACCAAATGATTATGAATAAAGGAGTT
TTTATGAAATTAATTATATTTTCATGGGCCTTAGGTTTTATGTTAGGTACTGTTCAAACA
TCATGGGTATCTAGTTTTCCCTTTTGTGGCCTTAATGAAATTAACCATATATCTTGTGAA
ACCCCAGCAGTGTTAGAACTTGCATGTGCAGACACGTTTTTGTTTGAAATCTATGCATTC
ACAGGCACCTTTTTGATTATTTTGGTTCCTTTCTTGTTGATACTCTTGTCTTACATTCGA
GTTCTGTTTGCCATCCTGAAGATGCCATCAACCACTGGGAGACAAAAGGCCTTTTCCACC
TGTGCCGCTCACCTCACATCTGTGACCCTATTCTATGGCACAGCCAGTATGACTTATTTA
CAACCCAAATCTGGCTACTCACCGGAAACCAAGAAAGTGATGTCATTGTCTTACTCACTT
CTGACACCACTGCTGAATCTGCTTATCTACAGTTTGCGAAATAGTGAGATGAAGAGGGCT
TTGATGAAATTATGGCGAAGGCGAGTGGTTTTACACACAATC
Conceptual translation MERQNQSCVVEFILLGFSNYPELQGQLFVAFLVIYLVTLIGNAIIIVIVSLDQSLHVPMY
LFLLNLSVVDLSFSAVIMPEMLVVLSTEKTTISFGGCFAQMYFILLFGGAECFLLGAMAY
DRFAAICHPLNYQMIMNKGVFMKLIIFSWALGFMLGTVQTSWVSSFPFCGLNEINHISCE
TPAVLELACADTFLFEIYAFTGTFLIILVPFLLILLSYIRVLFAILKMPSTTGRQKAFST
CAAHLTSVTLFYGTASMTYLQPKSGYSPETKKVMSLSYSLLTPLLNLLIYSLRNSEMKRA
LMKLWRRRVVLHTI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/G L/P 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G F/F 1000GP (YRI)
11 7,927,721 7,927,721 SYN G/T I/I 1000GP (CEU)
11 7,927,803 7,927,803 NS A/G L/P 1000GP (CEU, CHBJPT)
11 7,928,121 7,928,121 NS G/C T/S 1000GP (CEU)
11 7,928,160 7,928,160 NS A/G F/S 1000GP (CEU)
11 7,928,244 7,928,244 NS A/C V/G 1000GP (CEU, CHBJPT)
11 7,928,313 7,928,313 NS G/A A/V 1000GP (CEU, CHBJPT)
11 7,928,477 7,928,477 SYN A/G F/F 1000GP (CEU, CHBJPT)
11 7,949,350 7,949,350 NS A/G L/P rs4758258 (DbSNP)
11 7,949,791 7,949,791 NS A/C V/G rs7933807 (DbSNP)
11 7,949,860 7,949,860 NS A/G V/A rs7928451 (DbSNP)
11 7,950,024 7,950,024 SYN A/G F/F rs12272735 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R306* L287P S247P F168S V140G A117V % Freq CORP
1 R P S F G V 37.33 0.098
2 R P S F V A 35.02 0.098
3 R L S F V A 21.81 0.793
4 R P S F G A 1.92 0.098
5 * L S F V A 1.23 1.200
6 R P S S G V 0.92 0.304
7 R P S S V A 0.46 0.304
8 R L P F V A 0.46 0.793
9 R L S F G V 0.38 0.793
10 * L S F G A 0.15 1.200
11 R P S F V V 0.15 0.098
12 R L S F V V 0.08 0.793
13 R L S S V A 0.08 0.939

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10A6.aApr07-unspliced main_exon 3UTR chr11 7,927,634 7,927,721 -
CDS chr11 7,927,721 7,928,662 -