Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10C1 Olfactory Receptor

Gene Symbol OR10C11 (View this gene in GeneCards)
Family 10
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR6-31, AC004174, dJ994E9.5, hs6M1-17, HsOR6.3.22, ORL526, ORL363
External Ids HGNC: 8165   GeneBank: AF399627, BK004207, NM_013941   ORDB: ORL526, ORL363   
Build #39 labels OR10C1, OR10C2
Chromosomal location 6:29,440,016-29,440,951 (+)
Cluster 6@29
Synteny CLIC#12
Remarks Segregating Pseudo Gene, a nonsynonymous SNP rs17184009 (AA change=Q/* )

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10A4 58.25% 309
OR10A5 52.92% 308
OR10A7 54.75% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10C1 85% 311
Chimp CONTIG*********** 98% 312
Mouse Or10c1 86% 312
Rat Or10c1 85% 312
Cow OR10C1 86% 312

Expression evidences

Source Accession
mRNA BC136997
GNF Atlas2 221339_at

Sequence information

Nucleotide sequence ATGAGTGCAAACACCTCCATGGTGACTGAGTTTCTTCTTCTCGGCTTCTCCCACCTGGCC
GACCTCCAGGGCTTGCTCTTCTCTGTCTTTCTCACTATCTACCTGCTGACCGTGGCAGGC
AATTTCCTCATTGTGGTGCTGGTCTCCACTGATGCTGCCCTCCAGTCCCCTATGTACTTC
TTCCTGCGCACCCTCTCGGCCTTGGAGATTGGCTATACGTCTGTCACGGTCCCCCTGCTA
CTTCACCACCTCCTTACTGGCCGGCGCCACATCTCTCGCTCTGGATGTGCTCTCCAGATG
TTCTTCTTCCTCTTCTTTGGCGCCACGGAGTGCTGCCTCCTGGCAGCCATGGCCTATGAC
CGCTATGCAGCCATCTGTGAACCCCTCCGCTACCCACTGCTGCTGAGCCACCGGGTGTGT
CTACAGCTAGCTGGGTCGGCGTGGGCCTGTGGGGTGCTGGTGGGGCTGGGCCACACCCCT
TTCATCTTCTCTTTGCCCTTCTGCGGCCCCAATACCATCCCGCAGTTCTTCTGTGAGATC
CAGCCTGTCCTGCAGCTGGTATGTGGAGACACCTCGCTTAATGAACTGCAGATTATCCTG
GCAACAGCCCTCCTCATCCTCTGCCCCTTTGGCCTCATCCTGGGCTCCTACGGGCGTATC
CTCGTTACCATCTTCCGGATCCCATCTGTTGCGGGCCGCCGCAAGGCCTTCTCCACCTGC
TCCTCCCACCTGATCGTGGTCTCCCTCTTCTATGGCACCGCACTCTTTATCTATATTCGC
CCTAAGGCCAGCTACGATCCGGCCACTGACCCTCTGGTGTCCCTCTTCTATGCTGTGGTC
ACCCCCATCCTCAACCCCATCATCTACAGCCTGCGGAACACAGAGGTCAAAGCTGCCCTA
AAGAGAACCATCCAGAAAACGGTGCCTATGGAGATT
Conceptual translation MSANTSMVTEFLLLGFSHLADLQGLLFSVFLTIYLLTVAGNFLIVVLVSTDAALQSPMYF
FLRTLSALEIGYTSVTVPLLLHHLLTGRRHISRSGCALQMFFFLFFGATECCLLAAMAYD
RYAAICEPLRYPLLLSHRVCLQLAGSAWACGVLVGLGHTPFIFSLPFCGPNTIPQFFCEI
QPVLQLVCGDTSLNELQIILATALLILCPFGLILGSYGRILVTIFRIPSVAGRRKAFSTC
SSHLIVVSLFYGTALFIYIRPKASYDPATDPLVSLFYAVVTPILNPIIYSLRNTEVKAAL
KRTIQKTVPMEI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 nonsense SNP C/T Q/* 1000GP (YRI)
6 100 -100 NS C/T P/S 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
6 100 -100 SYN C/T F/F 1000GP (YRI, YRI, YRI, YRI)
6 29,407,893 29,407,893 NS A/G Y/C rs41271549 (DbSNP)
6 29,407,955 29,407,955 nonsense SNP C/T Q/* rs17184009 (DbSNP)
6 29,407,961 29,407,961 NS C/T P/S rs17184016 (DbSNP)
6 29,407,970 29,407,970 NS T/C F/L rs2074469 (DbSNP)
6 29,407,975 29,407,975 SYN C/T F/F rs11755177 (DbSNP)
6 29,408,057 29,408,057 NS A/C S/R rs11755182 (DbSNP)
6 29,408,090 29,408,090 NS A/G M/V rs17177632 (DbSNP)
6 29,408,153 29,408,153 NS C/T R/C rs17177639 (DbSNP)
6 29,408,204 29,408,204 NS C/T R/W rs17177646 (DbSNP)
6 29,408,270 29,408,270 NS T/C S/P rs2074468 (DbSNP)
6 29,408,275 29,408,275 NS C/A F/L rs2074467 (DbSNP)
6 29,408,278 29,408,278 SYN C/T I/I rs17184044 (DbSNP)
6 29,408,313 29,408,313 NS C/A P/Q rs2074466 (DbSNP)
6 29,408,476 29,408,476 SYN G/A P/P rs2074465 (DbSNP)
6 29,408,528 29,408,528 NS A/C/T V/M/L rs2074464 (DbSNP)
6 29,408,554 29,408,554 SYN A/C A/A rs10946991 (DbSNP)
6 29,408,555 29,408,555 NS A/C I/L rs17177674 (DbSNP)
6 29,408,600 29,408,600 NS G/T D/Y rs72482089 (DbSNP)
6 29,408,649 29,408,649 NS C/G P/R rs17184058 (DbSNP)
6 29,408,720 29,408,720 NS A/G M/V rs61735219 (DbSNP)
6 29,408,721 29,408,721 NS G/T R/M rs11968123 (DbSNP)
6 29,440,116 29,440,116 NS A/G Y/C 1000GP (CEU)
6 29,440,193 29,440,193 NS T/C F/L 1000GP (CEU, CHBJPT)
6 29,440,313 29,440,313 NS A/G M/V 1000GP (CHBJPT)
6 29,440,493 29,440,493 NS C/T P/S 1000GP (CEU)
6 29,440,536 29,440,536 NS C/A P/Q 1000GP (CEU, CHBJPT)
6 29,440,751 29,440,751 NS A/G M/V 1000GP (CEU, CHBJPT)
6 29,440,777 29,440,777 SYN A/C A/A 1000GP (CEU)
6 29,440,943 29,440,943 NS A/G M/V 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 29 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y34C Q55* P57S F60L R89S M93V R114C R131W P153S F154L P167Q M239V P260L D263Y P309T M310V M310R % Freq CORP
1 Y Q P F R M R R P F P M P D P M M 37.79 1.000
2 Y Q P F R M R R P F P V P D P M M 31.57 1.000
3 Y Q P L R M R R P F Q V P D P M M 14.06 1.000
4 Y Q P F R V R R S L P V P D P M M 5.68 1.000
5 Y * P F S M C W S F P V P D P M R 3.46 1.200
6 Y Q P L R M R R P F P V P D P M M 2.30 1.000
7 Y Q P F S M R R S F P V P D P M M 1.46 1.000
8 Y Q P F R V R R S L P M P D P M M 0.92 1.000
9 Y Q S F R M R R P F P V P D P M M 0.61 1.000
10 Y Q P F R V R R P F P V P D P M M 0.54 1.000
11 C Q P F R M R R S F P V P D T V M 0.46 1.000
12 Y Q P F R M R R P F Q V P D P M M 0.23 1.000
13 Y * P F S M C W S F P V P D P M M 0.23 1.200
14 Y Q P L R M R R S F P V P D P M M 0.15 1.000
15 Y Q P L R M R R P F Q V P Y P M M 0.08 1.000
16 Y Q P F R M R W P F P M P D P M M 0.08 1.000
17 Y * P F S M C W P F P V P D P M R 0.08 1.200
18 Y Q P F R M R R P F P M L D P M M 0.08 1.000
19 C Q P F R M R R S F P V P D P M M 0.08 1.000
20 Y * P F S M R R S F P V P D P M M 0.08 1.200
21 Y Q P F R V R R S F P V P D P M M 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10C1.aApr07-unspliced main_exon 5UTR chr6 29,439,306 29,440,016 +
CDS chr6 29,440,016 29,440,951 +
3UTR chr6 29,440,951 29,440,954 +