Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10H2 Olfactory Receptor

Gene Symbol OR10H21 (View this gene in GeneCards)
Family 10
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases OR19-23, AC004597-A, HsOR19.4.1, ORL312, ORL528
External Ids HGNC: 8173   GeneBank: AF399585, BC069085, BC069457, BK004211, NM_013939   ORDB: ORL312, ORL528   
Build #39 labels OR10H2
Chromosomal location 19:15,728,044-15,728,988 (+)
Cluster 19@16a
Synteny CLIC#46
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10H1 89.58% 307
OR10H5 88.42% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10H2 85% 313
Dog OR10H1E 83% 315
Dog OR10H1 83% 307
Chimp CONTIG716.57-870 97% 315
Mouse Or10h1 85% 311
Mouse Or10h1b 84% 311
Rat Or10h1c 84% 310
Rat Or10h1d 85% 310
Rat Or10h1 85% 303
Cow OR10H1 84% 311
Cow OR10H1F 82% 311
Cow OR10H1I 83% 310
Cow OR10H2 82% 308
Cow OR10H2B 82% 311
Cow OR10H1H 83% 314
Cow OR10H1G 83% 270

Expression evidences

Source Accession
ESTs BG197640
mRNA BC069457
GNF Atlas2 208543_at

Sequence information

Nucleotide sequence ATGCTGGGGCTAAACCACACCTCCATGTCTGAATTCATCCTCGTCGGCTTCTCTGCCTTC
CCCCACCTCCAACTGATGCTCTTCCTGCTGTTCCTGCTGATGTACCTGTTCACGCTGCTG
GGCAACCTGCTCATCATGGCCACCGTCTGGAGCGAGCGCAGCCTCCACACGCCCATGTAC
CTCTTCCTGTGCGTCCTCTCAGTCTCCGAGATCCTCTACACCGTGGCCATCATCCCGCGC
ATGCTGGCCGACCTGCTGTCCACCCAGCGCTCCATCGCCTTCCTGGCCTGTGCCAGTCAG
ATGTTCTTCTCCTTCAGCTTCGGCTTCACCCACTCCTTCCTGCTCACCGTCATGGGCTAC
GACCGCTACGTGGCCATCTGCCACCCCCTGCGCTACAACGTGCTCATGAGCCCACGGGGC
TGCGCCTGCCTGGTGGGCTGCTCCTGGGCTGGTGGCTCGGTCATGGGGATGGTGGTGACC
TCGGCCATTTTCCAACTGACTTTCTGTGGATCCCATGAGATCCAGCATTTTTTATGTCAT
GTGCCACCTCTGTTGAAGTTGGCCTGTGGAAATAATGTACCAGCTGTGGCCCTGGGCGTG
GGCTTGGTATGTATCATGGCACTGCTGGGCTGTTTTCTCCTCATCCTCCTCTCCTATGCC
TTCATCGTGGCCGACATCTTGAAGATCCCTTCTGCTGAAGGTCGGAACAAGGCCTTCTCC
ACCTGTGCCTCTCACCTTATTGTGGTCATTGTGCACTATGGCTTTGCCTCTGTCATCTAC
CTCAAGCCCAAAGGTCCCCACTCTCAGGAGGGTGACACCCTGATGGCCACCACCTACGCA
GTCCTCACGCCCTTCCTCAGCCCCATCATCTTCAGCCTCAGGAACAAAGAACTGAAGGTT
GCCATGAAGAGGACCTTCCTCAGCACACTCTATTCCTCAGGCACC
Conceptual translation MLGLNHTSMSEFILVGFSAFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMY
LFLCVLSVSEILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGY
DRYVAICHPLRYNVLMSPRGCACLVGCSWAGGSVMGMVVTSAIFQLTFCGSHEIQHFLCH
VPPLLKLACGNNVPAVALGVGLVCIMALLGCFLLILLSYAFIVADILKIPSAEGRNKAFS
TCASHLIVVIVHYGFASVIYLKPKGPHSQEGDTLMATTYAVLTPFLSPIIFSLRNKELKV
AMKRTFLSTLYSSGT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 100 -100 NS A/G I/V 1000GP (YRI)
19 100 -100 SYN G/A L/L 1000GP (YRI, YRI)
19 15,728,555 15,728,555 NS C/T S/F 1000GP (CEU, CHBJPT)
19 15,728,649 15,728,649 SYN G/A L/L 1000GP (CEU, CHBJPT)
19 15,838,858 15,838,857 Ins(1) -/G rs34844969 (DbSNP)
19 15,838,925 15,838,925 SYN A/G Q/Q rs61733112 (DbSNP)
19 15,838,967 15,838,967 SYN A/G T/T rs2285955 (DbSNP)
19 15,838,972 15,838,972 NS A/T Q/L rs4569397 (DbSNP)
19 15,839,081 15,839,081 SYN T/C A/A rs2067083 (DbSNP)
19 15,839,168 15,839,168 SYN T/C F/F rs2003905 (DbSNP)
19 15,839,174 15,839,174 SYN C/T F/F rs2285956 (DbSNP)
19 15,839,244 15,839,244 NS C/T R/C rs61731561 (DbSNP)
19 15,839,263 15,839,263 NS A/G N/S rs57001564 (DbSNP)
19 15,839,365 15,839,365 NS T/C F/S rs1806931 (DbSNP)
19 15,839,459 15,839,459 SYN A/G L/L rs11669315 (DbSNP)
19 15,839,496 15,839,496 NS A/G I/V rs61733113 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
19 15,777,409 15,839,459 CopyNumber Variation_8864 (DGV)
19 15,780,016 15,839,365 CopyNumber Variation_29687 (DGV)
19 15,780,041 15,851,261 CopyNumber Variation_3181 (DGV)
19 15,786,059 15,888,458 Inversion Variation_43709 (DGV)
19 15,838,754 15,841,798 CopyNumber #101 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S171F I215V % Freq CORP
1 S I 76.65 0.148
2 F I 20.05 0.148
3 S V 3.30 0.148

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10H2.aApr07-unspliced main_exon 5UTR chr19 15,728,024 15,728,044 +
CDS chr19 15,728,044 15,728,988 +
3UTR chr19 15,728,988 15,729,060 +