Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10J3 Olfactory Receptor

Gene Symbol OR10J31 (View this gene in GeneCards)
Family 10
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.2 (functional)
Aliases OR1-25, HsOR1.4.21P
External Ids HGNC: 14992   GeneBank: AB065445, AF399453, BK004532, NM_001004467   
Build #39 labels OR10J3P
Chromosomal location 1:159,313,673-159,314,659 (-)
Cluster 1@159b
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10J9P 77.46% 284

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10J3 88% 284
Chimp CONTIG705.104-27736 98% 329
Mouse Or10j3 87% 284
Rat Or10j3 87% 284
Cow OR10J3 82% 309

Expression evidences

Source Accession
mRNA AB529279
GNF Atlas2 gnf1h10883_at

Sequence information

Nucleotide sequence ATGCCAAAGCTAAATTCCACTTTTGTGACTGAGTTCCTCTTTGAAGGTTTCTCCAGCTTC
AGGCGGCAGCACAAACTTGTCTTCTTTGTTGTCTTCCTAACTTTGTACCTGCTGACTCTC
TCTGGCAATGTGATTATCATGACCATTATTCGCCTGGACCATCATCTTCACACCCCCATG
TACTTCTTCCTGTGCATGCTATCCATCTCTGAGACCTGCTACACTGTGGCCATCATTCCC
CATATGCTTTCTGGTCTCTTGAATCCTCATCAGCCCATTGCCACCCAAAGCTGTGCCACT
CAGCTCTTCTTCTATCTCACCTTTGGCATCAACAACTGCTTCCTGCTCACAGTCATGGGA
TATGACCGCTATGTGGCCATCTGCAACCCCCTAAGGTATTCAGTCATCATGGGTAAGAGG
GCCTGTATCCAACTGGCCTCTGGATCACTGGGGATTGGCCTTGGCATGGCCATTGTCCAA
GTAACATCTGTGTTTGGCCTGCCATTCTGTGATGCCTTTGTCATCTCCCACTTCTTCTGT
GATGTGAGACACCTGCTGAAGCTGGCCTGCACAGACACCACTGTCAATGAGATAATCAAC
TTTGTTGTCAGCGTCTGTGTCCTTGTTCTACCTATGGGCCTGGTCTTTATCTCCTATGTC
CTCATCATCTCCACCATTCTTAAGATTGCCTCAGCTGAAGGTCAGAAGAAGGCCTTTGCC
ACCTGCGCCTCCCACCTCACAGTGGTCATCATCCACTATGGCTGTGCCTCCATCATCTAC
CTGAAGCCTAAGTCCCAGAGTTCCCTGGGACAGGACAGACTCATCTCAGTGACCTACACT
CATCACTCCCCTACTGAACCCTGTTGTGTACAGCCTGAAGAACAAGGAGGTCAAAGATGC
TCTGCACAGAGCCGTGGGGCAAAAAACTCTGTCTCCTTAATGAAGAGAGGTTGTGAAGGC
TTTTCCTTTGCGTTTATAAATATGTAC
Conceptual translation MPKLNSTFVTEFLFEGFSSFRRQHKLVFFVVFLTLYLLTLSGNVIIMTIIRLDHHLHTPM
YFFLCMLSISETCYTVAIIPHMLSGLLNPHQPIATQSCATQLFFYLTFGINNCFLLTVMG
YDRYVAICNPLRYSVIMGKRACIQLASGSLGIGLGMAIVQVTSVFGLPFCDAFVISHFFC
DVRHLLKLACTDTTVNEIINFVVSVCVLVLPMGLVFISYVLIISTILKIASAEGQKKAFA
TCASHLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEEQGGQRC
SAQSRGAKNSVSLMKRGCEGFSFAFINMY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/T G/R 1000GP (YRI, YRI)
1 159,283,494 159,283,494 NS C/T G/E rs58037016 (DbSNP)
1 159,283,746 159,283,746 NS C/T R/Q rs11265165 (DbSNP)
1 159,313,704 159,313,704 NS T/C E/G 1000GP (CEU, CHBJPT)
1 159,313,956 159,313,956 NS T/C Q/R 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
1 159,281,463 159,284,549 CopyNumber #104 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E319G G270R Q235R I222M R183T I175M I69V L52P % Freq CORP
1 E G Q I R I I L 77.19 0.214
2 G G R I R I I L 11.44 0.214
3 E G R I R I I L 9.83 0.214
4 E R Q I R I I L 0.38 0.214
5 E G Q I R I V L 0.31 0.214
6 G G Q I R I I L 0.23 0.214
7 E G R I R I I P 0.15 0.214
8 G G R M R I I L 0.15 0.214
9 E G Q I R M I L 0.15 0.214
10 E G Q I T I I L 0.08 0.214
11 E G Q I R I I P 0.08 0.214

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10J3.aApr07-unspliced main_exon 3UTR chr1 159,313,670 159,313,673 -
CDS chr1 159,313,673 159,314,659 -
OR10J3.bApr07 exon_3UTR chr1 159,312,919 159,313,514 -
main_exon CDS_partial chr1 159,314,562 159,314,659 -
5UTR chr1 159,314,659 159,314,684 -
exon_5UTR chr1 159,364,324 159,364,509 -
exon_5UTR chr1 159,468,842 159,469,084 -