Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10J5 Olfactory Receptor

Gene Symbol OR10J51 (View this gene in GeneCards)
Family 10
Subfamily J
Pseudogene No
CORP pseudogene probability score
Aliases OR1-28, HsOR1.4.27, ORL3018
External Ids HGNC: 14993   GeneBank: AB065443, AY284357-AY284388, BK004290, NM_001004469   ORDB: ORL3018   
Build #39 labels OR10J5
Chromosomal location 1:159,535,081-159,536,007 (-)
Cluster 1@159b
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10J6P 75.73% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10J5 85% 308
Chimp CONTIG519.152-3113 98% 309
Mouse Or10j5 87% 309
Rat Or10j5 87% 309
Cow OR10J5 83% 306

Expression evidences

Source Accession
mRNA AB529280

Sequence information

Nucleotide sequence ATGAAGAGAAAGAACTTCACAGAAGTGTCAGAATTCATTTTCTTGGGATTTTCTAGCTTT
GGAAAGCATCAGATAACCCTCTTTGTGGTTTTCCTAACTGTCTACATTTTAACTCTGGTT
GCTAACATCATCATTGTGACTATCATCTGCATTGACCATCATCTCCACACTCCCATGTAT
TTCTTCCTAAGCATGCTGGCTAGTTCAGAGACGGTGTACACACTGGTCATTGTGCCACGA
ATGCTTTTGAGCCTCATTTTTCATAACCAACCTATCTCCTTGGCAGGCTGTGCTACACAA
ATGTTCTTTTTTGTTATCTTGGCCACTAATAATTGCTTCCTGCTTACTGCAATGGGGTAT
GACCGCTATGTGGCCATCTGCAGACCCCTGAGATACACTGTCATCATGAGCAAGGGACTA
TGTGCCCAGCTGGTGTGTGGGTCCTTTGGCATTGGTCTGACTATGGCAGTTCTCCATGTG
ACAGCCATGTTCAATTTGCCGTTCTGTGGCACAGTGGTAGACCACTTCTTTTGTGACATT
TACCCAGTCATGAAACTTTCTTGCATTGATACCACTATCAATGAGATAATAAATTATGGT
GTAAGTTCATTTGTGATTTTTGTGCCCATAGGCCTGATATTTATCTCCTATGTCCTTGTC
ATCTCTTCCATCCTTCAAATTGCCTCAGCTGAGGGCCGGAAGAAGACCTTTGCCACCTGT
GTCTCCCACCTCACTGTGGTTATTGTCCACTGTGGCTGTGCCTCCATTGCCTACCTCAAG
CCGAAGTCAGAAAGTTCAATAGAAAAAGACCTTGTTCTCTCAGTGACGTACACCATCATC
ACTCCCTTGCTGAACCCTGTTGTTTACAGTCTGAGAAACAAGGAGGTAAAGGATGCCCTA
TGCAGAGTTGTGGGCAGAAATATTTCT
Conceptual translation MKRKNFTEVSEFIFLGFSSFGKHQITLFVVFLTVYILTLVANIIIVTIICIDHHLHTPMY
FFLSMLASSETVYTLVIVPRMLLSLIFHNQPISLAGCATQMFFFVILATNNCFLLTAMGY
DRYVAICRPLRYTVIMSKGLCAQLVCGSFGIGLTMAVLHVTAMFNLPFCGTVVDHFFCDI
YPVMKLSCIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTFATC
VSHLTVVIVHCGCASIAYLKPKSESSIEKDLVLSVTYTIITPLLNPVVYSLRNKEVKDAL
CRVVGRNIS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS T/A Y/F 1000GP (YRI)
1 100 -100 SYN C/T P/P 1000GP (YRI)
1 159,505,101 159,505,101 NS A/G W/R rs35393723 (DbSNP)
1 159,505,202 159,505,202 NS A/T F/Y rs56786307 (DbSNP)
1 159,505,297 159,505,297 SYN C/T P/P rs4656837 (DbSNP)
1 159,535,311 159,535,311 NS G/A R/W 1000GP (CEU)
1 159,535,507 159,535,507 SYN C/T P/P 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R233W Y199F C188Y I92V F12L % Freq CORP
1 R Y C I F 88.17 0.288
2 W Y C I F 9.06 0.250
3 R F C I F 2.00 0.288
4 R Y C I L 0.46 0.288
5 W Y C V F 0.15 0.357
6 W Y Y I F 0.15 0.257

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10J5.aApr07-unspliced main_exon 3UTR chr1 159,535,078 159,535,081 -
CDS chr1 159,535,081 159,536,007 -