Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10P1 Olfactory Receptor

Gene Symbol OR10P11 (View this gene in GeneCards)
Family 10
Subfamily P
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases OR12-7, HsOR12.5.26
External Ids HGNC: 15378   GeneBank: AB065867, AF399489, BK004259, NM_206899   
Build #39 labels OR10P1P, OR10P2P, OR10P3P
Chromosomal location 12:55,636,892-55,637,830 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10A4 49.84% 309
OR10A7 48.22% 309
OR10C1 51.46% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10P24P 78% 313
Chimp CONTIG802.40-21646 99% 314
Mouse Or10p1 85% 311
Rat Or10p1 82% 305
Cow OR10P1 86% 313

Expression evidences

Source Accession
mRNA AB529283

Sequence information

Nucleotide sequence ATGGCTGGGGAAAACCATACTACACTGCCTGAATTCCTCCTTCTGGGATTCTCTGACCTC
AAGGCCCTGCAGGGCCCCCTGTTCTGGGTGGTGCTTCTGGTCTACCTGGTCACCTTGCTG
GGTAACTCCCTGATCATCCTCCTCACACAGGTCAGCCCTGCCCTGCACTCCCCCATGTAC
TTCTTCCTGCGCCAACTCTCAGTGGTGGAGCTCTTCTACACCACTGACATCGTGCCCAGG
ACCCTGGCCAATCTGGGCTCCCCGCATCCCCAGGCCATCTCTTTCCAGGGCTGTGCAGCC
CAGATGTACGTCTTCATTGTCCTGGGCATCTCGGAGTGCTGCCTGCTCACGGCCATGGCC
TATGACCGATATGTTGCCATCTGCCAGCCCCTACGCTATTCCACCCTCTTGAGCCCACGG
GCCTGCATGGCCATGGTGGGTACCTCCTGGCTCACAGGCATCATCACGGCCACCACCCAT
GCCTCCCTCATCTTCTCTCTACCTTTTCGCAGCCACCCGATCATCCCGCACTTTCTCTGT
GACATCCTGCCAGTACTGAGGCTGGCAAGTGCTGGGAAGCACAGGAGCGAGATCTCCGTG
ATGACAGCCACCATAGTCTTCATTATGATCCCCTTCTCTCTGATTGTCACCTCTTACATC
CGCATCCTGGGTGCCATCCTAGCAATGGCCTCCACCCAGAGCCGCCGCAAGGTCTTCTCC
ACCTGCTCCTCCCATCTGCTCGTGGTCTCTCTCTTCTTTGGAACAGCCAGCATCACCTAC
ATCCGGCCGCAGGCAGGCTCCTCTGTTACCACAGACCGCGTCCTCAGTCTCTTCTACACA
GTCATCACACCCATGCTCAACCCCATCATCTACACCCTTCGGAACAAGGACGTGAGGAGG
GCCCTGCGACACTTGGTGAAGAGGCAGCGCCCCTCACCC
Conceptual translation MAGENHTTLPEFLLLGFSDLKALQGPLFWVVLLVYLVTLLGNSLIILLTQVSPALHSPMY
FFLRQLSVVELFYTTDIVPRTLANLGSPHPQAISFQGCAAQMYVFIVLGISECCLLTAMA
YDRYVAICQPLRYSTLLSPRACMAMVGTSWLTGIITATTHASLIFSLPFRSHPIIPHFLC
DILPVLRLASAGKHRSEISVMTATIVFIMIPFSLIVTSYIRILGAILAMASTQSRRKVFS
TCSSHLLVVSLFFGTASITYIRPQAGSSVTTDRVLSLFYTVITPMLNPIIYTLRNKDVRR
ALRHLVKRQRPSP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 56,031,273 56,031,273 NS A/G M/V rs7970885 (DbSNP)
12 56,030,814 56,030,814 NS C/G L/V rs12231050 (DbSNP)
12 56,030,938 56,030,938 NS C/T P/L rs10876838 (DbSNP)
12 56,031,611 56,031,611 SYN A/G S/S rs11171631 (DbSNP)
12 56,030,921 56,030,921 SYN A/G L/L rs7305623 (DbSNP)
12 55,637,154 55,637,154 NS C/T P/L 1000GP (CEU, CHBJPT)
12 55,637,489 55,637,489 NS G/A V/M 1000GP (CEU, CHBJPT)
12 55,637,827 55,637,827 SYN A/G S/S 1000GP (CEU, CHBJPT)
12 55,637,782 55,637,782 SYN C/T D/D 1000GP (CHBJPT)
12 100 -100 SYN A/G Q/Q 1000GP (YRI, YRI, YRI, YRI)
12 100 -100 NS C/T P/L 1000GP (YRI, YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P88L R140W V200M I215F R262Q % Freq CORP
1 P R V I R 67.82 0.248
2 L R M I R 30.18 0.248
3 P R V F R 1.15 0.248
4 P R V I Q 0.38 0.248
5 P R M I R 0.31 0.248
6 L R V I R 0.08 0.248
7 P W M I R 0.08 0.248

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10P1.aApr07-unspliced main_exon CDS chr12 55,636,892 55,637,830 +
3UTR chr12 55,637,830 55,637,833 +