Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10Q2P Olfactory Receptor

Gene Symbol OR10Q2P1 (View this gene in GeneCards)
Family 10
Subfamily Q
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-234, HsOR11.12.13P, ORL3628
External Ids HGNC: 15135   GeneBank: BK004630, NG_004249   ORDB: ORL3628   
Build #39 labels OR10Q2P
Chromosomal location 11:58,291,829-58,292,771 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10Q1 86.47% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10Q2 87% 307
Chimp CONTIG229.250-11028 96% 315
Mouse Or10q1 82% 308
Mouse Or10q1b 82% 303
Rat Or10q1 82% 304
Cow OR10Q1 80% 307

Expression evidences

Source Accession
GNF Atlas2 gnf1h10858_at

Sequence information

Nucleotide sequence CTTGCGTGGTAACCTGTCTTCAACCAGTCTGCCCCACTGAGTTTGTGTTCCGTGTGTTCA
CCACAGTCCCTGAATTTCAGGTTCTTCTCTTCCTTCTCTTCCTCCTCTTCTACTTGATGA
TCCTCTGTGGCAACACAGCCATCATCTGGGTTGTGTGCACATACAGCGTTCTCCGAACCC
CAATGTATTTCTTCTTGTCCAACCTGTCCTTTGTAGAGATCTGCTACACCACCGTTGTGG
TGCCCTTGATGCTTTCCAACATTTTTGGGGCCCAGAAGCCCATTCCATTGGCTGGATGTG
GGGCCCAAATGTTCTTCTTTCTCACACTTGGTGGTGCTGACTGTTTCCTCTTGGCGATCG
TGGCCTATGACCGCTATGTGGCCATCTGCCACCCTTTGCACTACCCCTCATCATGACCTG
CAATCTGTGCGTGCAGATGCTGGGCGGCGCTGTGGGCCTGGCCCTCTTCCTCTCCCTGCA
GCTCACCGCCTTAATCTTCACCTTGCCCTTCTGCGGCTACCGCCAGGAAATTAACCACTT
CCTCTGCGATGTACCTCCCGTCCTGCGCCTGGCCTGCGCTGCCATCCGTGTTCACCAGGC
TGTCCTCTATGTCGTGAGCATCCTCGTGCTGACCGTCCCCTTCTTGCTCATCTGCGTCTC
CTACGTGTTCATCACCTGTGCCATCCTGAGCATCCGTTCTGCTGAGGGCCGCCACCAGGC
CTTCTCCACCTGCTCCTCCCACCTCACCGTGGTCCTGCTGCAGTATGGCTGCTGTGCCTT
GGCATACTTGCATCCCCAGTCCAGCTCCTCTGCAGATGAGGATCGCCAGTTTGCCCTTGT
TTACACCTTTATCACACCATTACTCAACCCTTTGATTTACACCCTTAGGAACAAGGATGT
CAAAGGTGCCCTTGAAAAAAGTGCTCAGTACCAAAGGGACACC
Conceptual translation LAWXVFNQS/PTEFVFRVFTTVPEFQVLLFLLFLLFYLMILCGNTAIIWVVCTYSVLR
TPMYFFLSNLSFVEICYTTVVVPLMLSNIFGAQKPIPLAGCGAQMFFFLTLGGADCFLLA
IVAYDRYVAICHPLHY/LIMTCNLCVQMLGGAVGLALFLSLQLTALIFTLPFCGYRQEI
NHFLCDVPPVLRLACAAIRVHQAVLYVVSILVLTVPFLLICVSYVFITCAILSIRSAEGR
HQAFSTCSSHLTVVLLQYGCCALAYLHPQSSSSADEDRQFALVYTFITPLLNPLIYTLRN
KDVKGALEKSAQYQRDT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 58,059,338 58,059,338 SNP C/G rs55983896 (DbSNP)
11 58,059,421 58,059,421 SNP A/G rs10896742 (DbSNP)
11 58,059,524 58,059,524 SNP C/G rs61743465 (DbSNP)
11 58,059,530 58,059,530 SNP C/T rs12270110 (DbSNP)
11 58,059,571 58,059,571 SNP G/A rs61744693 (DbSNP)
11 58,059,584 58,059,584 SNP G/A rs61747149 (DbSNP)
11 58,059,726 58,059,726 SNP A/G rs12295189 (DbSNP)
11 58,059,793 58,059,793 SNP A/G rs12295247 (DbSNP)
11 58,059,884 58,059,884 SNP C/T rs12288500 (DbSNP)
11 58,059,957 58,059,957 SNP C/T rs1938642 (DbSNP)
11 58,060,010 58,060,010 SNP A/C rs12225538 (DbSNP)
11 58,060,082 58,060,082 SNP A/G rs7109083 (DbSNP)
11 58,060,162 58,060,162 SNP A/C rs71486412 (DbSNP)
11 58,060,192 58,060,192 SNP C/T rs12289961 (DbSNP)
11 58,291,866 58,291,866 SNP C/G 1000GP (CEU, CHBJPT)
11 58,291,949 58,291,949 SNP A/G 1000GP (CEU, CHBJPT)
11 58,292,058 58,292,058 SNP T/C 1000GP (CEU, CHBJPT)
11 58,292,254 58,292,254 SNP A/G 1000GP (CEU, CHBJPT)
11 58,292,321 58,292,321 SNP A/G 1000GP (CEU, CHBJPT)
11 58,292,412 58,292,412 SNP C/T 1000GP (CEU, CHBJPT)
11 58,292,485 58,292,485 SNP T/C 1000GP (CEU, CHBJPT)
11 58,292,610 58,292,610 SNP A/G 1000GP (CEU, CHBJPT)
11 58,292,720 58,292,720 SNP C/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 31 (Hasin)
11 58,057,301 58,060,343 Deletion #226 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.