Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10R2 Olfactory Receptor

Gene Symbol OR10R21 (View this gene in GeneCards)
Family 10
Subfamily R
Pseudogene No
CORP pseudogene probability score
Aliases OR1-8, HsOR1.4.5, ORL3012
External Ids HGNC: 14820   GeneBank: AB065640, AF399582, BK004191, NM_001004472   ORDB: ORL3012   
Build #39 labels OR10R2
Chromosomal location 1:158,479,911-158,480,882 (+)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10R3P 76.38% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10R3B 77% 309
Chimp CONTIG*********** 99% 324
Mouse Or10k2 56% 310
Rat Or10j7 55% 305
Cow OR10R2 91% 316

Expression evidences

Source Accession
ESTs DB344720
mRNA AB529285
GNF Atlas2 gnf1h08734_at

Sequence information

Nucleotide sequence ATGTTTTACTTCTTTCCCCCTTTGCAGATCTTGGCAGAAAACCTCACCATGGTCACCGAA
TTCCTGTTGCTGGGTTTTTCCAGCCTTGGTGAAATTCAGCTGGCCCTCTTTGTAGTTTTT
CTTTTTCTGTATCTAGTCATTCTTAGTGGCAATGTCACCATTATCAGTGTCATCCACCTG
GATAAAAGCCTCCACACACCAATGTACTTCTTCCTTGGCATTCTCTCAACATCTGAGACC
TTCTACACCTTTGTCATTCTACCCAAGATGCTCATCAATCTACTTTCTGTGGCCAGGACA
ATCTCCTTCAACTGTTGTGCTCTTCAAATGTTCTTCTTCCTTGGTTTTGCCATTACCAAC
TGCCTGCTATTGGGTGTGATGGGTTATGATCGCTATGCTGCCATTTGTCACCCTCTGCAT
TACCCCACTCTTATGAGCTGGCAGGTGTGTGGAAAACTGGCAGCTGCCTGTGCAATTGGT
GGCTTCTTGGCCTCTCTTACAGTAGTAAATTTAGTTTTCAGCCTCCCTTTTTGTAGCGCC
AACAAAGTCAATCATTACTTCTGTGACATCTCAGCAGTCATTCTTCTGGCTTGTACCAAC
ACAGATGTTAACGAATTTGTGATATTCATTTGTGGAGTTCTTGTACTTGTGGTTCCCTTT
CTGTTTATCTGTGTTTCTTATCTCTGCATTCTGAGGACTATCCTGAAGATTCCCTCAGCT
GAGGGCAGACGGAAAGCGTTTTCCACCTGCGCCTCTCACCTCAGTGTTGTTATTGTTCAT
TATGGCTGTGCTTCCTTCATCTACCTGAGGCCTACAGCAAACTATGTGTCCAACAAAGAC
AGGCTGGTGACGGTGACATACACGATTGTCACTCCATTACTAAACCCCATGGTTTATAGC
CTCAGAAACAAGGATGTCCAACTTGCTATCAGAAAAGTGTTGGGCAAGAAAGGTTCTCTA
AAACTATATAAT
Conceptual translation MFYFFPPLQILAENLTMVTEFLLLGFSSLGEIQLALFVVFLFLYLVILSGNVTIISVIHL
DKSLHTPMYFFLGILSTSETFYTFVILPKMLINLLSVARTISFNCCALQMFFFLGFAITN
CLLLGVMGYDRYAAICHPLHYPTLMSWQVCGKLAAACAIGGFLASLTVVNLVFSLPFCSA
NKVNHYFCDISAVILLACTNTDVNEFVIFICGVLVLVVPFLFICVSYLCILRTILKIPSA
EGRRKAFSTCASHLSVVIVHYGCASFIYLRPTANYVSNKDRLVTVTYTIVTPLLNPMVYS
LRNKDVQLAIRKVLGKKGSLKLYN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS A/G M/V 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 158,449,749 158,449,749 NS A/G M/V rs61739693 (DbSNP)
1 158,449,758 158,449,758 NS A/G K/E rs62621279 (DbSNP)
1 158,449,835 158,449,835 SYN A/C L/L rs62642483 (DbSNP)
1 158,449,854 158,449,854 NS A/G I/V rs62642484 (DbSNP)
1 158,450,145 158,450,145 NS A/G M/V rs61741730 (DbSNP)
1 158,450,192 158,450,192 SYN C/T A/A rs61741711 (DbSNP)
1 158,450,238 158,450,238 NS A/G T/A rs3820678 (DbSNP)
1 158,450,314 158,450,314 NS A/G E/G rs6679056 (DbSNP)
1 158,450,382 158,450,382 NS C/T L/F rs1418843 (DbSNP)
1 158,450,412 158,450,412 NS C/T P/S rs6666585 (DbSNP)
1 158,450,451 158,450,451 NS A/G T/A rs62642485 (DbSNP)
1 158,450,529 158,450,529 NS A/T T/S rs62621280 (DbSNP)
1 158,450,563 158,450,563 NS C/T T/M rs62642486 (DbSNP)
1 158,480,352 158,480,352 nonsense SNP C/T Q/* 1000GP (CHBJPT)
1 158,480,402 158,480,402 SYN C/T A/A 1000GP (CEU)
1 158,480,448 158,480,448 NS G/A A/T 1000GP (CEU, CHBJPT)
1 158,480,524 158,480,524 NS A/G E/G 1000GP (CEU, CHBJPT)
1 158,480,592 158,480,592 NS C/T L/F 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M17V E20K V52I Q148* A180T V183D E205G L228F P238S A251T S277T T288M % Freq CORP
1 M E V Q A V E L P A S T 42.40 0.289
2 M E V Q A V G F P A S T 22.81 0.289
3 M E V Q T V G F P A S T 19.74 0.289
4 M E V Q A V G L P A S T 4.84 0.289
5 M E V Q A V G F P T S T 2.92 0.289
6 V E V Q A V E L P A S T 2.61 0.289
7 M E V Q A V G L P A S M 1.15 0.289
8 M E V Q A V G L S A S T 1.08 0.289
9 M E I Q A V E L P A S T 0.69 0.289
10 M E V * A V E L P A S T 0.61 1.200
11 M K V Q A V E L P A T T 0.46 0.289
12 M K V Q A V E L P A S T 0.31 0.289
13 M E V Q T V G L P A S T 0.31 0.289
14 M E V Q T D G F P A S T 0.08 0.289

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10R2.aApr07-unspliced main_exon 5UTR chr1 158,479,878 158,479,911 +
CDS chr1 158,479,911 158,480,882 +
3UTR chr1 158,480,882 158,480,885 +