Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10T2 Olfactory Receptor

Gene Symbol OR10T21 (View this gene in GeneCards)
Family 10
Subfamily T
Pseudogene No
CORP pseudogene probability score
Aliases OR1-3, HsOR1.4.1, ORL3011
External Ids HGNC: 14816   GeneBank: AB065643, BK004364, NM_001004475   ORDB: ORL3011   
Build #39 labels OR10T2
Chromosomal location 1:158,398,525-158,399,466 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10R2 59.93% 307
OR10R3P 59.4% 298
OR10T1P 63.07% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10T2 91% 314
Chimp CONTIG705.9-10215 98% 315
Mouse Or10b1-ps 57% 303
Rat Or10j2 56% 300
Cow OR10T2 91% 313

Expression evidences

Source Accession
mRNA AB528820

Sequence information

Nucleotide sequence ATGCGAGGTTTCAACAAAACCACTGTGGTTACACAGTTCATCCTGGTGGGTTTCTCCAGC
CTGGGGGAGCTCCAGCTGCTGCTTTTTGTCATCTTTCTTCTCCTATACTTGACAATCCTG
GTGGCCAATGTGACCATCATGGCCGTTATTCGCTTCAGCTGGACTCTCCACACTCCCATG
TATGGCTTTCTATTCATCCTTTCATTTTCTGAGTCCTGCTACACTTTTGTCATCATCCCT
CAGCTGCTGGTCCACCTGCTCTCAGACACCAAGACCATCTCCTTCATGGCCTGTGCCACC
CAGCTGTTCTTTTTCCTTGGCTTTGCTTGCACCAACTGCCTCCTCATTGCTGTGATGGGA
TATGATCGCTATGTAGCAATTTGTCACCCTCTGAGGTACACACTCATCATAAACAAAAGG
CTGGGGTTGGAGTTGATTTCTCTCTCAGGAGCCACAGGTTTCTTTATTGCTTTGGTGGCC
ACCAACCTCATTTGTGACATGCGTTTTTGTGGCCCCAACAGGGTTAACCACTATTTCTGT
GACATGGCACCTGTTATCAAGTTAGCCTGCACTGACACCCATGTGAAAGAGCTGGCTTTA
TTTAGCCTCAGCATCCTGGTAATTATGGTGCCTTTTCTGTTAATTCTCATATCCTATGGC
TTCATAGTTAACACCATCCTGAAGATCCCCTCAGCTGAGGGCAAGAAGGCCTTTGTCACC
TGTGCCTCACATCTCACTGTGGTCTTTGTCCACTATGGCTGTGCCTCTATCATCTATCTG
CGGCCCAAGTCCAAGTCTGCCTCAGACAAGGATCAGTTGGTGGCAGTGACCTACACAGTG
GTTACTCCCTTACTTAATCCTCTTGTCTACAGTCTGAGGAACAAAGAGGTAAAAACTGCA
TTGAAAAGAGTTCTTGGAATGCCTGTGGCAACCAAGATGAGC
Conceptual translation MRGFNKTTVVTQFILVGFSSLGELQLLLFVIFLLLYLTILVANVTIMAVIRFSWTLHTPM
YGFLFILSFSESCYTFVIIPQLLVHLLSDTKTISFMACATQLFFFLGFACTNCLLIAVMG
YDRYVAICHPLRYTLIINKRLGLELISLSGATGFFIALVATNLICDMRFCGPNRVNHYFC
DMAPVIKLACTDTHVKELALFSLSILVIMVPFLLILISYGFIVNTILKIPSAEGKKAFVT
CASHLTVVFVHYGCASIIYLRPKSKSASDKDQLVAVTYTVVTPLLNPLVYSLRNKEVKTA
LKRVLGMPVATKMS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS A/G V/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN G/A S/S 1000GP (YRI, YRI)
1 158,368,321 158,368,321 NS C/G K/N rs6692949 (DbSNP)
1 158,368,392 158,368,392 NS C/T V/I rs61818748 (DbSNP)
1 158,368,541 158,368,541 NS A/G V/A rs34465440 (DbSNP)
1 158,368,794 158,368,794 NS A/G F/L rs12062580 (DbSNP)
1 158,368,846 158,368,846 NS C/T M/I rs6662382 (DbSNP)
1 158,368,915 158,368,915 SYN G/T L/L rs56704148 (DbSNP)
1 158,368,964 158,368,964 NS C/T C/Y rs61818749 (DbSNP)
1 158,368,974 158,368,974 NS A/G F/L rs61818750 (DbSNP)
1 158,369,025 158,369,025 NS C/T V/I rs6662597 (DbSNP)
1 158,369,064 158,369,064 NS A/G F/L rs41488350 (DbSNP)
1 158,369,210 158,369,210 NS A/G V/A rs6660222 (DbSNP)
1 158,398,525 158,398,525 SYN G/A S/S 1000GP (CEU, CHBJPT)
1 158,398,566 158,398,566 SYN A/G L/L 1000GP (CEU)
1 158,398,602 158,398,602 NS C/T V/I 1000GP (CEU)
1 158,398,751 158,398,751 NS A/G V/A 1000GP (CEU, CHBJPT)
1 158,399,056 158,399,056 NS T/C I/M 1000GP (CEU, CHBJPT)
1 158,399,174 158,399,174 NS C/T C/Y 1000GP (CEU, CHBJPT)
1 158,399,184 158,399,184 NS A/G F/L 1000GP (CEU, CHBJPT)
1 158,399,274 158,399,274 NS A/G F/L 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

K312N V289I V239A D181H R168H F155L I137M C98Y F95L I78V F65L N43S V16A % Freq CORP
1 K V V D R F I C F I F N V 62.29 0.474
2 K V A D R F M C F I F N V 19.97 0.389
3 K V A D R F M Y L I L N V 9.45 0.981
4 K I V D R F I C F I F N V 2.15 0.474
5 K V V D R L I C F I F N V 1.84 0.474
6 K V A D R F M C F V F N A 0.69 0.389
7 K V A D R F M C F I F N A 0.69 0.389
8 K V A D R F M C L I L N V 0.54 0.389
9 N V A D R F M C F I F N V 0.54 0.389
10 K V A D R F M C F I F S V 0.46 1.000
11 K V A D R F M C F I L N V 0.38 0.389
12 K V A H R F M C F I F N V 0.31 0.389
13 K V V D R F M C F I F N V 0.23 0.389
14 K V A D R F M Y L I F N V 0.23 0.981
15 K V V D H F I C F I F N V 0.08 0.474
16 K I V D R L I C F I F N V 0.08 0.474
17 K V V D R F I C F I L N V 0.08 0.474

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10T2.aApr07-unspliced main_exon 3UTR chr1 158,398,522 158,398,525 -
CDS chr1 158,398,525 158,399,466 -