Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10V1 Olfactory Receptor

Gene Symbol OR10V11 (View this gene in GeneCards)
Family 10
Subfamily V
Pseudogene No
CORP pseudogene probability score
Aliases OR11-256, HsOR11.13.13, ORL3312
External Ids HGNC: 15136   GeneBank: AB065807, AF399593, BK004323, NM_001005324   ORDB: ORL3312   
Build #39 labels OR10V1
Chromosomal location 11:59,712,919-59,713,845 (-)
Cluster 11@59b
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10Q1 55.78% 303
OR10Q2P 55.63% 302
OR10V2P 62.4% 250

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10V1 84% 309
Chimp CONTIG*********** 99% 309
Mouse Or10v1 90% 309
Rat Or10v1 88% 309
Cow OR10V1 80% 308

Expression evidences

Source Accession
mRNA AB529286
GNF Atlas2 gnf1h05541_at

Sequence information

Nucleotide sequence ATGGAAGGAATAAATAAAACTGCAAAGATGCAGTTTTTCTTTCGTCCATTCTCACCTGAC
CCTGAGGTCCAGATGCTGATTTTTGTGGTCTTCCTGATGATGTATCTGACCAGCCTCGGT
GGAAATGCTACAATTGCAGTCATTGTTCAGATCAATCATTCCCTCCACACCCCCATGTAC
TTTTTCCTGGCTAATCTGGCAGTTCTAGAAATCTTCTATACATCTTCCATCACCCCATTG
GCCTTGGCAAACCTCCTTTCAATGGGCAAAACTCCTGTTTCCATCACGGGATGTGGCACC
CAGATGTTTTTCTTTGTCTTCTTGGGTGGGGCTGATTGTGTCCTGCTGGTAGTCATGGCT
TATGACCAGTTTATAGCGATCTGTCACCCTCTGCGATACAGGCTCATCATGAGCTGGTCC
TTGTGTGTGGAGCTGCTGGTAGGCTCCTTGGTGCTGGGGTTCCTGTTGTCACTGCCACTC
ACCATTTTAATCTTCCATCTCCCATTCTGCCACAATGATGAGATCTACCACTTCTACTGT
GACATGCCTGCAGTCATGCGCCTGGCTTGTGCAGACACACGCGTTCACAAGACTGCTCTG
TATATCATCAGCTTCATCGTCCTTAGCATCCCCCTCTCATTGATCTCCATCTCCTATGTC
TTCATCGTGGTAGCCATTTTACGGATCCGGTCAGCAGAAGGGCGCCAGCAAGCCTACTCT
ACCTGCTCTTCTCACATCTTAGTGGTCCTCCTGCAGTATGGCTGCACCAGCTTTATATAC
TTGTCCCCCAGTTCCAGCTACTCTCCTGAGATGGGCCGGGTGGTATCTGTGGCCTACACA
TTTATCACTCCCATTTTAAACCCCTTGATCTATAGTTTGAGGAACAAGGAACTGAAAGAT
GCCCTAAGGAAAGCATTGAGAAAATTC
Conceptual translation MEGINKTAKMQFFFRPFSPDPEVQMLIFVVFLMMYLTSLGGNATIAVIVQINHSLHTPMY
FFLANLAVLEIFYTSSITPLALANLLSMGKTPVSITGCGTQMFFFVFLGGADCVLLVVMA
YDQFIAICHPLRYRLIMSWSLCVELLVGSLVLGFLLSLPLTILIFHLPFCHNDEIYHFYC
DMPAVMRLACADTRVHKTALYIISFIVLSIPLSLISISYVFIVVAILRIRSAEGRQQAYS
TCSSHILVVLLQYGCTSFIYLSPSSSYSPEMGRVVSVAYTFITPILNPLIYSLRNKELKD
ALRKALRKF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 59,480,952 59,480,952 nonsense SNP A/G */Q rs499037 (DbSNP)
11 59,480,969 59,480,969 NS A/G V/A rs472177 (DbSNP)
11 59,481,311 59,481,311 NS C/T G/E rs12364373 (DbSNP)
11 59,480,951 59,480,951 NS T/C Q/R rs499033 (DbSNP)
11 59,481,016 59,481,016 SYN T/C Q/Q rs537595 (DbSNP)
11 59,713,496 59,713,496 NS A/G V/A 1000GP (CEU, CHBJPT)
11 59,713,646 59,713,646 NS G/T A/E 1000GP (CEU)
11 59,713,543 59,713,543 SYN C/T Q/Q 1000GP (CEU, CHBJPT)
11 59,713,478 59,713,478 NS T/C Q/R 1000GP (CEU, CHBJPT)
11 59,713,464 59,713,464 NS A/T C/S 1000GP (CEU)
11 59,713,287 59,713,287 NS G/A R/C 1000GP (CHBJPT)
11 59,713,479 59,713,479 nonsense SNP G/A Q/* 1000GP (CHBJPT)
11 100 -100 SYN G/A V/V 1000GP (YRI, YRI)
11 100 -100 NS T/. H/X 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 nonsense SNP G/A Q/* 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

H196R R187C Q123* V117A A67E % Freq CORP
1 H R Q V A 82.95 0.908
2 H R Q A A 7.53 0.908
3 H R * A A 5.53 1.200
4 H R Q A E 2.07 0.428
5 H C Q V A 0.77 0.908
6 R R Q A A 0.54 0.908
7 H R Q V E 0.46 0.428
8 H R * V A 0.15 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10V1.aApr07-unspliced main_exon 3UTR chr11 59,712,916 59,712,919 -
CDS chr11 59,712,919 59,713,845 -