Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11H6 Olfactory Receptor

Gene Symbol OR11H61 (View this gene in GeneCards)
Family 11
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.08 (functional)
Aliases OR14-35, HsOR14.1.27, ORL3699
External Ids HGNC: 15349   GeneBank: AB065889, BK004454, NM_001004480   ORDB: ORL3699   
Build #39 labels OR11H6
Chromosomal location 14:20,223,779-20,224,699 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11H2 66.89% 299
OR11H4 68.4% 307
OR11H5P 68.35% 297

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11H6 89% 307
Chimp CONTIG*********** 69% 297
Chimp CONTIG*********** 68% 307
Chimp CONTIG3485.9-6200 68% 299
Mouse Or11h6 84% 307
Rat Or11h6 86% 290
Cow OR11H6 89% 307

Expression evidences

Source Accession
mRNA AB529290
GNF Atlas2 gnf1h02182_at

Sequence information

Nucleotide sequence ATGCATTTTGTGACTGAGTTTGTCCTCCTGGGTTTCCATGGTCAAAGGGAGATGCAGAGC
TGCTTCTTCTCATTCATCCTGGTTCTCTATCTCCTGACACTGCTAGGGAATGGAGCTATT
GTCTGTGCAGTGAAATTGGACAGGCGGCTCCACACACCCATGTACATCCTTCTGGGAAAC
TTTGCCTTTCTAGAGATCTGGTACATTTCCTCCACTGTCCCAAACATGCTAGTCAATATC
CTCTCTGAGATTAAAACCATCTCCTTCTCTGGTTGCTTCCTGCAATTCTATTTCTTTTTT
TCACTGGGTACAACAGAGTGTTTCTTTTTATCAGTTATGGCTTATGATCGGTACCTGGCC
ATCTGTCGTCCATTACACTACCCCTCCATCATGACTGGGAAGTTCTGTATAATTCTGGTC
TGTGTATGCTGGGTAGGCGGATTTCTCTGCTATCCAGTCCCTATTGTTCTTATCTCCCAA
CTTCCCTTCTGTGGGCCCAACATCATTGACCACTTGGTGTGTGACCCAGGCCCATTGTTT
GCACTGGCCTGCATCTCTGCTCCTTCCACTGAGCTTATCTGTTACACCTTCAACTCGATG
ATTATCTTTGGGCCCTTCCTCTCCATCTTGGGATCTTACACTCTGGTCATCAGAGCTGTG
CTTTGTATTCCCTCTGGTGCTGGTCGAACTAAAGCTTTCTCCACATGTGGGTCCCACCTA
ATGGTGGTGTCTCTATTCTATGGAACCCTTATGGTGATGTATGTGAGCCCAACATCAGGG
AACCCAGCAGGAATGCAGAAGATCATCACTCTGGTATACACAGCAATGACTCCATTCTTA
AATCCCCTTATCTATAGTCTTCGAAACAAAGACATGAAAGATGCTCTAAAGAGAGTCCTG
GGGTTAACAGTTAGCCAAAAC
Conceptual translation MHFVTEFVLLGFHGQREMQSCFFSFILVLYLLTLLGNGAIVCAVKLDRRLHTPMYILLGN
FAFLEIWYISSTVPNMLVNILSEIKTISFSGCFLQFYFFFSLGTTECFFLSVMAYDRYLA
ICRPLHYPSIMTGKFCIILVCVCWVGGFLCYPVPIVLISQLPFCGPNIIDHLVCDPGPLF
ALACISAPSTELICYTFNSMIIFGPFLSILGSYTLVIRAVLCIPSGAGRTKAFSTCGSHL
MVVSLFYGTLMVMYVSPTSGNPAGMQKIITLVYTAMTPFLNPLIYSLRNKDMKDALKRVL
GLTVSQN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 NS C/G L/V 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
14 100 -100 SYN C/T Y/Y 1000GP (YRI)
14 20,223,803 20,223,803 NS C/G L/V 1000GP (CEU, CHBJPT)
14 20,224,029 20,224,029 NS T/C I/T 1000GP (CEU, CHBJPT)
14 20,224,132 20,224,132 SYN C/T Y/Y 1000GP (CEU, CHBJPT)
14 20,224,294 20,224,294 NS G/T L/F 1000GP (CEU, CHBJPT)
14 20,224,415 20,224,415 NS T/C Y/H 1000GP (CEU, CHBJPT)
14 20,224,436 20,224,436 NS G/C V/L 1000GP (CEU)
14 20,224,484 20,224,484 NS T/C C/R 1000GP (CEU, CHBJPT)
14 20,691,962 20,691,962 NS C/G L/V rs9323693 (DbSNP)
14 20,692,188 20,692,188 NS C/T T/I rs12891553 (DbSNP)
14 20,692,291 20,692,291 SYN C/T Y/Y rs34693535 (DbSNP)
14 20,692,305 20,692,305 NS A/G H/R rs17106351 (DbSNP)
14 20,692,453 20,692,453 NS G/T L/F rs17211285 (DbSNP)
14 20,692,574 20,692,574 NS C/T H/Y rs17277221 (DbSNP)
14 20,692,595 20,692,595 NS C/G L/V rs61993884 (DbSNP)
14 20,692,643 20,692,643 NS C/T R/C rs17277228 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L32V G59E I107T R146H G156R L195F Y236H V243L C259R T297R % Freq CORP
1 L G I R G L Y V C T 41.32 0.424
2 L G T R G F H V R T 33.49 0.424
3 V G I R G L Y V C T 10.29 0.424
4 L G I H G L Y V C T 8.91 0.424
5 L G T R G F H L R T 4.76 0.574
6 L G T R G F H V C T 0.23 0.424
7 L E T R G F H V R T 0.15 0.424
8 L G I R G F H V R T 0.15 0.424
9 L G T R G L H V R T 0.15 0.424
10 L G T R G F H V R R 0.15 0.424
11 L G T R R F H V R T 0.08 0.424
12 L G I R G F Y V C T 0.08 0.424
13 L G T R G F Y V R T 0.08 0.424
14 L G T R G F Y V C T 0.08 0.424
15 L G I R G L Y L R T 0.08 0.574

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11H6.aApr07-unspliced main_exon 5UTR chr14 20,223,710 20,223,779 +
CDS chr14 20,223,779 20,224,699 +
3UTR chr14 20,224,699 20,224,702 +