Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11H7P Olfactory Receptor

Gene Symbol OR11H7P1 (View this gene in GeneCards)
Family 11
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR14-32, HsOR14.1.28P, ORL70
External Ids HGNC: 15350   GeneBank: AB065888, AF399477, AF546294-AF546307, AY284389-AY284420, BK004619, NG_004354   ORDB: ORL70   
Build #39 labels OR11H7P
Chromosomal location 14:20,229,402-20,230,343 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks Segregating Pseudo Gene, a nonsynonymous SNP rs1953558 (AA change=*/Q )

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11H4 68.15% 314
OR11H5P 66.22% 296
OR11H6 65.47% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11H7 85% 314
Chimp CONTIG794.48-1288 68% 314
Chimp CONTIG794.43-2919 67% 296
Chimp CONTIG117344.1-120 97% 197
Mouse Or11h7 80% 313
Rat Or11h23-ps 80% 313
Cow OR11H7 85% 314

Expression evidences

Source Accession
mRNA AB529249
GNF Atlas2 gnf1h11153_at

Sequence information

Nucleotide sequence ATGAATAACTCACAGATATCTACTGTGACGCAGTTTGTGTTGTTGGGGTTTCCTGGTCCC
TGGAAAATTCAGATCATCTTTTTCTCAATGATTTTGTTGGTCTACATCTTCACTCTGACT
GGGAATATGGCCATCATCTGTGCAGTGAGGTGGGACCATCGACTCCATACCCCTATGTAC
GTGCTCCTAGCCAACTTCTCCTTCCTAGAGATCTGGTATGTGACCTGCACAGTCCCCAAC
ATGCTGGTAAATTTTTTCTCCAAAACTAAGACCATATCATTCTCTGGATGTTTCACTCAG
TTCCACTTCTTCTTTTCCCTGGGCACAACTGAATGCTTCTTCCTCTGTGTCATGGCTTAT
GATCGGTACCTGGCCATCTGCCACCCACTGCACTATCCCTCCATTATGACTGGCCAGCTC
TGTGGCATCTTGGTGTCTCTTTGTTGGCTCATTGGTTTCCTTGGACATTCAATTTCCATT
TTCTTCATTTTTCAACTACCTTTCTGTGGTCCCAACATCATTGATCATTTTCTGTGTGAT
GTAGACCCACTGATGGCATTGTCCTCTGCCCCTACTCACATCATAGGGCATGTGTTCCAT
TCTGTGAGCTCTCTTTTCATCAACCTCACCATGGTGTACATCCTTGGGTCCTATACCTTG
GTGCTCAGAACTGTGCTTTAGGTTCCTTCTTCAGCTGGATGGCAAAAGGCCATCTCTACC
TGTGGGTCACACTTGGTTGTTGTGTCTCTGTTCTATGGAGCCATAATGCTGATGTATGTG
AGTCCCACACCTGGCAACTCAGTTGCTATGCATAAGCTCATCACACTGATATATTCTGTG
GTAACACCTGTCTTAAACCCCCTCATCTACAGCCTACGCAACAAGGACATGAAATATGCC
CTCCATCATGTCTTCTGTGGAATGAGAATTATCCAGAGATCA
Conceptual translation MNNSQISTVTQFVLLGFPGPWKIQIIFFSMILLVYIFTLTGNMAIICAVRWDHRLHTPMY
VLLANFSFLEIWYVTCTVPNMLVNFFSKTKTISFSGCFTQFHFFFSLGTTECFFLCVMAY
DRYLAICHPLHYPSIMTGQLCGILVSLCWLIGFLGHSISIFFIFQLPFCGPNIIDHFLCD
VDPLMALSSAPTHIIGHVFHSVSSLFINLTMVYILGSYTLVLRTVLXPSSAGWQKAIST
CGSHLVVVSLFYGAIMLMYVSPTPGNSVAMHKLITLIYSVVTPVLNPLIYSLRNKDMKYA
LHHVFCGMRIIQRS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 SNP T/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
14 20,229,430 20,229,430 SNP C/T 1000GP (CEU)
14 20,229,441 20,229,441 SNP T/G 1000GP (CEU, CHBJPT)
14 20,229,626 20,229,626 SNP C/T 1000GP (CEU)
14 20,229,909 20,229,909 SNP G/T 1000GP (CEU, CHBJPT)
14 20,230,080 20,230,080 SNP T/C 1000GP (CEU, CHBJPT)
14 20,230,139 20,230,139 SNP T/G 1000GP (CEU, CHBJPT)
14 20,230,290 20,230,290 SNP A/G 1000GP (CEU)
14 20,697,589 20,697,589 SNP C/T rs61993889 (DbSNP)
14 20,697,600 20,697,600 SNP G/T rs12434822 (DbSNP)
14 20,698,021 20,698,020 Ins(1) -/C rs34053624 (DbSNP)
14 20,698,068 20,698,068 SNP G/T rs4981844 (DbSNP)
14 20,698,239 20,698,239 rescued_nonsense C/T rs1953558 (DbSNP)
14 20,698,298 20,698,298 SNP G/T rs1953559 (DbSNP)
14 20,698,449 20,698,449 SNP A/G rs11625707 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,697,461 20,700,502 CopyNumber #90 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.