Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13C3 Olfactory Receptor

Gene Symbol OR13C31 (View this gene in GeneCards)
Family 13
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.31 (functional)
Aliases OR9-8, HsOR9.4.3, ORL3222
External Ids HGNC: 14704   GeneBank: AB065713, BK004410, NM_001001961   ORDB: ORL3222   
Build #39 labels OR13C3
Chromosomal location 9:104,535,773-104,536,723 (-)
Cluster 9@107
Synteny CLIC#19
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13C4 83.91% 317

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13C3 90% 317
Chimp CONTIG378.163-7967 98% 317
Mouse Or13c3 86% 314
Rat Or13c3b 85% 316
Rat Or13c3 85% 316
Rat Or13c3c 85% 316
Rat Or13c3g 84% 316
Cow OR13C3 88% 317

Expression evidences

Source Accession
mRNA AB529293
GNF Atlas2 gnf1h02221_at

Sequence information

Nucleotide sequence ATGGGTGAGATTAACCAGACACTTGTGTCAGAATTTCTTCTTCTGGGTCTTTCTGGATAC
CCAAAGATTGAGATTGTTTACTTTGCTCTCATTCTAGTTATGTACCTAGTGATTCTAATT
GGCAATGGTGTTCTAATCATAGCCAGCATCTTTGATTCTCATTTTCACACACCAATGTAC
TTCTTCCTGGGCAACCTCTCTTTCCTGGATATCTGCTATACATCCTCCTCTGTTCCCTCA
ACATTGGTGAGCTTAATCTCAAAGAAAAGAAACATTTCCTTCTCTGGATGTGCAGTGCAG
ATGTTCTTTGGGTTTGCAATGGGGTCAACAGAATGTCTGCTTCTTGGCATGATGGCATTT
GATCGTTATGTGGCCATCTGCAACCCACTGAGATACCCCATCATCCTGAGCAAGGTGGCG
TATGTATTGATGGCTTCTGTGTCCTGGCTGTCCGGTGGAATAAATTCAGCTGTGCAAACA
TTACTTGCCATGAGACTGCCTTTCTGTGGGAATAATATTATCAATCATTTCGCATGTGAA
ATATTAGCTGTCCTCAAGCTGGCCTGTGCTGATATATCCCTCAATATTATCACCATGGTG
ATATCAAATATGGCCTTCCTGGTTCTTCCACTGATGGTCATTTTTTTCTCCTATATGTTC
ATCCTCTACACCATCTTGCAAATGAATTCAGCCACAGGAAGACGCAAGGCATTTTCCACG
TGCTCAGCTCACCTGACTGTGGTGATCATATTTTACGGTACCATCTTCTTTATGTATGCG
AAACCGAAGTCTCAAGACCTGATTGGGGAAGAAAAATTGCAAGCATTAGACAAGCTCATT
TCTCTGTTTTATGGGGTAGTGACACCCATGCTGAATCCTATACTCTATAGCTTGAGAAAT
AAGGATGTAAAAGCTGCTGTAAAATATTTGCTGAACAAAAAACCAATTCAC
Conceptual translation MGEINQTLVSEFLLLGLSGYPKIEIVYFALILVMYLVILIGNGVLIIASIFDSHFHTPMY
FFLGNLSFLDICYTSSSVPSTLVSLISKKRNISFSGCAVQMFFGFAMGSTECLLLGMMAF
DRYVAICNPLRYPIILSKVAYVLMASVSWLSGGINSAVQTLLAMRLPFCGNNIINHFACE
ILAVLKLACADISLNIITMVISNMAFLVLPLMVIFFSYMFILYTILQMNSATGRRKAFST
CSAHLTVVIIFYGTIFFMYAKPKSQDLIGEEKLQALDKLISLFYGVVTPMLNPILYSLRN
KDVKAAVKYLLNKKPIH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 nonsense SNP A/C L/* 1000GP (YRI)
9 100 -100 NS T/G K/T 1000GP (YRI, YRI, YRI, YRI)
9 100 -100 SYN T/C V/V 1000GP (YRI, YRI, YRI, YRI)
9 104,536,004 104,536,004 SYN C/T T/T 1000GP (CEU, CHBJPT)
9 104,536,163 104,536,163 SYN C/T L/L 1000GP (CEU, CHBJPT)
9 104,536,255 104,536,255 NS C/T A/T 1000GP (CHBJPT)
9 104,536,720 104,536,720 NS C/A G/C 1000GP (CEU, CHBJPT)
9 107,298,217 107,298,217 NS G/T T/K rs10512330 (DbSNP)
9 107,298,285 107,298,285 SYN C/T T/T rs41312212 (DbSNP)
9 107,298,444 107,298,444 SYN C/T L/L rs41305445 (DbSNP)
9 107,298,827 107,298,827 NS G/A H/Y rs61742435 (DbSNP)
9 107,298,957 107,298,957 SYN G/A G/G rs61738863 (DbSNP)
9 107,299,001 107,299,001 NS A/C C/G rs41304943 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

K293T M258T M229V L191* A187T Y90H E41* G32C % Freq CORP
1 K M M L A Y E G 87.79 0.959
2 K M M L A Y E C 9.98 0.959
3 T M M L A H E G 0.69 0.959
4 K M V L A Y E G 0.61 0.959
5 K T M L A Y E G 0.54 0.959
6 K M M L T Y E G 0.23 0.959
7 K M M * A Y E G 0.08 1.200
8 K M M L A Y * C 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13C3.aApr07-unspliced main_exon 3UTR chr9 104,535,770 104,535,773 -
CDS chr9 104,535,773 104,536,723 -
5UTR chr9 104,536,723 104,536,813 -