Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13G1 Olfactory Receptor

Gene Symbol OR13G11 (View this gene in GeneCards)
Family 13
Subfamily G
Pseudogene No
CORP pseudogene probability score
Aliases ORL3016
External Ids HGNC: 14999   ORDB: ORL3016   
Build #39 labels
Chromosomal location 1:247,672,118-247,673,041 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13A1 50% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13G1 82% 307
Mouse Or13g1 85% 306
Rat Or13g1 86% 306
Cow OR12J2 56% 303

Expression evidences

Source Accession
mRNA AB529295

Sequence information

Nucleotide sequence ATGAATCACAGCGTTGTAACTGAGTTCATTATTCTGGGCCTCACCAAAAAGCCTGAACTC
CAGGGAATTATCTTCCTCTTTTTTCTCATTGTCTATCTTGTGGCTTTTCTCGGCAACATG
CTCATCATCATTGCCAAAATCTATAACAACACCTTGCATACGCCCATGTATGTTTTCCTT
CTGACACTGGCTGTTGTGGACATCATCTGCACAACAAGCATCATACCGAAGATGCTGGGG
ACCATGCTAACATCAGAAAATACCATTTCATATGCAGGCTGCATGTCCCAGCTCTTCTTG
TTCACATGGTCTCTGGGAGCTGAGATGGTTCTCTTCACCACCATGGCCTATGACCGCTAT
GTGGCCATTTGTTTCCCTCTTCATTACAGTACTGTTATGAACCACCATATGTGTGTAGCC
TTGCTCAGCATGGTCATGGCTATTGCAGTCACCAATTCCTGGGTGCACACAGCTCTTATC
ATGAGGTTGACTTTCTGTGGGCCAAACACCATTGACCACTTCTTCTGTGAGATACCCCCA
TTGCTGGCTTTGTCCTGTAGCCCTGTAAGAATCAATGAGGTGATGGTGTATGTTGCTGAT
ATTACCCTGGCCATAGGGGACTTTATTCTTACCTGCATCTCCTATGGTTTTATCATTGTT
GCTATTCTCCGTATCCGCACAGTAGAAGGCAAGAGGAAGGCCTTCTCAACATGCTCATCT
CATCTCACAGTGGTGACCCTTTACTATTCTCCTGTAATCTACACCTATATCCGCCCTGCT
TCCAGCTATACATTTGAAAGAGACAAGGTGGTAGCTGCACTCTATACTCTTGTGACTCCC
ACATTAAACCCGATGGTGTACAGCTTCCAGAATAGGGAGATGCAGGCAGGAATTAGGAAG
GTGTTTGCATTTCTGAAACACTAG
Conceptual translation MNHSVVTEFIILGLTKKPELQGIIFLFFLIVYLVAFLGNMLIIIAKIYNNTLHTPMYVFL
LTLAVVDIICTTSIIPKMLGTMLTSENTISYAGCMSQLFLFTWSLGAEMVLFTTMAYDRY
VAICFPLHYSTVMNHHMCVALLSMVMAIAVTNSWVHTALIMRLTFCGPNTIDHFFCEIPP
LLALSCSPVRINEVMVYVADITLAIGDFILTCISYGFIIVAILRIRTVEGKRKAFSTCSS
HLTVVTLYYSPVIYTYIRPASSYTFERDKVVAALYTLVTPTLNPMVYSFQNREMQAGIRK
VFAFLKH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/A R/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN A/G N/N 1000GP (YRI, YRI, YRI)
1 247,672,270 247,672,270 NS G/A R/C 1000GP (CHBJPT)
1 247,672,372 247,672,372 NS G/A R/C 1000GP (CEU, CHBJPT)
1 247,672,477 247,672,477 NS C/G V/L 1000GP (CEU)
1 247,672,606 247,672,606 NS T/A M/L 1000GP (CEU, CHBJPT)
1 247,672,648 247,672,648 NS T/C I/V 1000GP (CEU, CHBJPT)
1 247,672,706 247,672,706 SYN G/A F/F 1000GP (CEU, CHBJPT)
1 247,672,905 247,672,905 NS T/A K/I 1000GP (CEU, CHBJPT)
1 247,835,651 247,835,651 NS C/A K/N rs61995673 (DbSNP)
1 247,835,674 247,835,674 NS A/G C/R rs28446289 (DbSNP)
1 247,835,728 247,835,728 NS C/T G/R rs28523507 (DbSNP)
1 247,835,768 247,835,768 SYN G/A N/N rs61997172 (DbSNP)
1 247,835,779 247,835,779 NS C/G V/L rs56096718 (DbSNP)
1 247,835,908 247,835,908 NS A/T L/M rs28556931 (DbSNP)
1 247,835,950 247,835,950 NS T/C I/V rs1151640 (DbSNP)
1 247,836,008 247,836,008 SYN A/G F/F rs28555391 (DbSNP)
1 247,836,074 247,836,074 SYN A/T S/S rs28402945 (DbSNP)
1 247,836,078 247,836,078 NS C/A S/I rs61742803 (DbSNP)
1 247,836,207 247,836,207 NS A/T I/K rs28711149 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,833,420 247,836,443 Deletion #183 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R258C K231N R224C A199T V189L M146L I132V H128R I89S K46I % Freq CORP
1 R K R A V M V H I K 41.01 0.036
2 R K C A V L I H I I 31.57 0.036
3 R K R A V M I H I K 20.12 0.036
4 R K R A L M I H I K 2.30 0.036
5 R N R A V M I H I K 1.69 0.030
6 R K R A V M I R I K 1.54 0.036
7 R K R A V M I H S K 0.77 0.059
8 R K C A V M I H I K 0.31 0.036
9 R K R A V L I H I K 0.15 0.036
10 R K R T V M V H I K 0.15 0.036
11 R K C A V L I H I K 0.15 0.036
12 C K R A V M V H I K 0.08 0.036
13 R N R A V M V H I K 0.08 0.030
14 R K R A V L V H I K 0.08 0.036

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13G1.aApr07-unspliced main_exon CDS chr1 247,672,118 247,673,041 -