Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13H1 Olfactory Receptor

Gene Symbol OR13H11 (View this gene in GeneCards)
Family 13
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.32 (functional)
Aliases ORX1, HsORX.1.5
External Ids HGNC: 14755   GeneBank: AB065938, AF399633, AY284421-AY284452, BK004524, NM_001004486   
Build #39 labels OR13H1
Chromosomal location X:131,544,074-131,544,997 (+)
Cluster X@131b
Synteny CLIC#48
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13C9 47.13% 314
OR13D1 47.39% 306
OR13D2P 49.83% 295

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13H2P 77% 308
Chimp CONTIG10351.1-2739 98% 308
Mouse Or13d1 49% 311
Rat Or13d1 50% 309
Cow OR13H1 84% 308

Expression evidences

Source Accession
mRNA AB529233

Sequence information

Nucleotide sequence ATGGCCATGGACAATGTCACAGCAGTGTTTCAGTTTCTCCTTATTGGCATTTCTAACTAT
CCTCAATGGAGAGACACGTTTTTCACATTAGTGCTGATAATTTACCTCAGCACATTGTTG
GGGAATGGATTTATGATCTTTCTTATTCACTTTGACCCCAACCTCCACACTCCAATCTAC
TTCTTCCTTAGTAACCTGTCTTTCTTAGACCTTTGTTATGGAACAGCTTCCATGCCCCAG
GCTTTGGTGCATTGTTTCTCTACCCATCCCTACCTCTCTTATCCCCGATGTTTGGCTCAA
ACGAGTGTCTCCTTGGCTTTGGCCACAGCAGAGTGCCTCCTACTGGCTGCCATGGCCTAT
GACCGTGTGGTTGCTATCAGCAATCCCCTGCGTTATTCAGTGGTTATGAATGGCCCAGTA
TGTGTCTGCTTGGTTGCTACCTCATGGGGGACATCACTTGTGCTCACTGCCATGCTCATC
CTATCCCTGAGGCTTCACTTCTGTGGGGCTAATGTCATCAACCATTTTGCCTGTGAGATT
CTCTCCCTCATTAAGCTGACCTGTTCTGATACCAGCCTCAATGAATTTATGATCCTCATC
ACCAGTATCTTCACCCTGCTGCTACCATTTGGGTTTGTTCTCCTCTCCTACATACGAATT
GCTATGGCTATCATAAGGATTCGCTCACTCCAGGGCAGGCTCAAGGCCTTTACCACATGT
GGCTCTCACCTGACCGTGGTGACAATCTTCTATGGGTCAGCCATCTCCATGTATATGAAA
ACTCAGTCCAAGTCCTACCCTGACCAGGACAAGTTTATCTCAGTGTTTTATGGAGCTTTG
ACACCCATGTTGAACCCCCTGATATATAGCCTGAGAAAAAAAGATGTTAAACGGGCAATA
AGGAAAGTTATGTTGAAAAGGACA
Conceptual translation MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIY
FFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAY
DRVVAISNPLRYSVVMNGPVCVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEI
LSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTTC
GSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRAI
RKVMLKRT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
X 130,678,287 130,678,287 SYN A/G Q/Q rs61748340 (DbSNP)
X 130,678,467 130,678,467 SYN A/G V/V rs499030 (DbSNP)
X 130,678,596 130,678,596 SYN C/G L/L rs17316625 (DbSNP)
X 130,678,844 130,678,844 NS A/C Y/S rs655415 (DbSNP)
X 130,678,940 130,678,940 NS A/G Q/R rs57328754 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 146 (Hasin)
X 130,677,948 130,680,971 Deletion #316 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13H1.aApr07-unspliced main_exon CDS chrX 131,544,074 131,544,997 +
3UTR chrX 131,544,997 131,545,000 +