Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13J1 Olfactory Receptor

Gene Symbol OR13J11 (View this gene in GeneCards)
Family 13
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.69 (pseudogene)
Aliases OR9-2, HsOR9.1.2, ORL3231
External Ids HGNC: 15108   GeneBank: AB065705, AF399603, AY726589, BK004442, NM_001004487   ORDB: ORL3231   
Build #39 labels OR13J1
Chromosomal location 9:35,869,466-35,870,401 (-)
Cluster 9@36
Synteny CLIC#17
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13D1 51.47% 307
OR13D2P 54.4% 307
OR2K2 53.09% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13J1 85% 312
Chimp CONTIG247.293-2169 98% 311
Mouse Or13j1 82% 312
Rat Or13j1 82% 312
Cow OR13J1 85% 312
Cow OR13J1D 84% 312
Cow OR13J1B 85% 312
Cow OR13J1F 85% 312
Cow OR13J1C 84% 312
Cow OR13J1E 84% 312

Expression evidences

Source Accession
ESTs BF946493
mRNA AY726589
GNF Atlas2 gnf1h02247_at

Sequence information

Nucleotide sequence ATGGAGCCGCTCAACAGAACAGAGGTGTCCGAGTTCTTTCTGAAAGGATTTTCTGGCTAC
CCAGCCCTGGAGCATCTGCTCTTCCCTCTGTGCTCAGCCATGTACCTGGTGACCCTCCTG
GGGAACACAGCCATCATGGCGGTGAGCGTGCTAGATATCCACCTGCACACGCCCGTGTAC
TTCTTCCTGGGCAACCTCTCTACCCTGGACATCTGCTACACGCCCACCTTTGTGCCTCTG
ATGCTGGTCCACCTCCTGTCATCCCGGAAGACCATCTCCTTTGCTGTCTGTGCCATCCAG
ATGTGTCTGAGCCTGTCCACGGGCTCCACGGAGTGCCTGCTACTGGCCATCACGGCCTAT
GACCGCTACCTGGCCATCTGCCAGCCACTCAGGTACCACGTGCTCATGAGCCACCGGCTC
TGCGTGCTGCTGATGGGAGCTGCCTGGGTCCTCTGCCTCCTCAAGTCGGTGACTGAGATG
GTCATCTCCATGAGGCTGCCCTTCTGTGGCCACCACGTGGTCAGTCACTTCACCTGCAAG
ATCCTGGCAGTGCTGAAGCTGGCATGCGGCAACACGTCGGTCAGCGAAGACTTCCTGCTG
GCGGGCTCCATCCTGCTGCTGCCTGTACCCCTGGCATTCATCTGCCTGTCCTACTTGCTC
ATCCTGGCCACCATCCTGAGGGTGCCCTCGGCCGCCAGGTGCTGCAAAGCCTTCTCCACC
TGCTTGGCACACCTGGCTGTAGTGCTGCTTTTCTACGGCACCATCATCTTCATGTACTTG
AAGCCCAAGAGTAAGGAAGCCCACATCTCTGATGAGGTCTTCACAGTCCTCTATGCCATG
GTCACGACCATGCTGAACCCCACCATCTACAGCCTGAGGAACAAGGAGGTGAAGGAGGCC
GCCAGGAAGGTGTGGGGCAGGAGTCGGGCCTCCAGG
Conceptual translation MEPLNRTEVSEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVLDIHLHTPVY
FFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTECLLLAITAY
DRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRLPFCGHHVVSHFTCK
ILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSAARCCKAFST
CLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVFTVLYAMVTTMLNPTIYSLRNKEVKEA
ARKVWGRSRASR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 35,870,001 35,870,001 NS C/T R/H rs7044405 (DbSNP)
9 35,870,225 35,870,225 SYN A/G P/P rs72727089 (DbSNP)
9 35,870,228 35,870,228 SYN G/A P/P 1000GP (CEU, CHBJPT)
9 35,870,004 35,870,004 NS T/C H/R 1000GP (CEU, CHBJPT)
9 100 -100 SYN G/A Y/Y 1000GP (YRI, YRI, YRI)
9 100 -100 NS T/C H/R 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 117 (Hasin)
9 35,867,463 35,870,498 CopyNumber #143 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T282A H133R T43I % Freq CORP
1 T R T 63.98 0.802
2 T H T 35.18 0.802
3 T R I 0.77 0.802
4 A R T 0.08 0.802

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13J1.aApr07-unspliced main_exon 3UTR chr9 35,869,463 35,869,466 -
CDS chr9 35,869,466 35,870,401 -