Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13Z1P Olfactory Receptor

Gene Symbol OR13Z1P1 (View this gene in GeneCards)
Family 13
Subfamily Z
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR1.3.1P
External Ids HGNC: 31240   GeneBank: NG_004405   
Build #39 labels
Chromosomal location 1:147,419,005-147,419,897 (+)
Cluster 1@147
Synteny CLIC#3
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13Z2P 69.61% 181

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length

Sequence information

Nucleotide sequence TATTTTATTTATCTCCCAATATTCATTTCAGTTGAGAAAGAATTCAAAGTAGTAAATCAA
ATGGTGGTCACTGAATTCATCTTTTTAAATTTTTCCAAGCACCCTGCATTACAAATGGTT
TTCTTCCTGTTCTCCTTGGTCATTTACCTGATATCTCTTCTGGGAAATGCAGTCAGGGTC
AGTCCTGCCTTCTATACTCCAGTGGGTTATTTTCTTAGCCACTTAAGCTTCCTGGATATC
TGCTACATGTCTACCACCATCCTGGTCATGCTGGTGAACTTCTTCCAGGAGAGTAAGACC
ATCTCTTATGAGGGCTGCCTTTCCCAGATCTTCTTCCTTGCATTATGAGCCAGCACTGAG
GGGGTTTTGCTGGCTGCCATAGCTTATGACCACTGTGTGGCTATTTGCCACCGTCTTCAA
TATAGGCTCCTAATGAGTGGAAAGGTCTATGTTTGTTTGGTGACTGGGTTTTGGATGTGT
GGGCTACTCAATTCTGGGACACACACAGCACTGACAGCCACACTCACTGCGTGAACCCAA
CCCCATCAGCTGCTTTCTCTGTGCCATCCCATTGCTCCTGAAGCTCTCCTGCTCAGACAC
CTGTCAGTGAGTCTGTGCTCCATGTGGTGAGGGCCACCACTGGCCTGAGCCCCTGCCTGT
TTATGGCAATGTCCTACATATTCATCATCTCTACCATCTTTGGAACAGACCACTTCAACT
ATGACAGGCCCACAGAAGGGTGCTCCCTGGACACAGACATCCTGGTCTCTGTGCTCTTTT
GTGTTGTGACCCCAGTGTTGAACCCCATCACCTACAGCCTGAGAAACAAGGAGATCAAGG
GTGCAGTGATGAGGCTGACAGGAAAACATGAATTCTCTAGTGAGGTCACTGAC
Conceptual translation YFIYLPIFISVEKEFKVVNQMVVTEFIFLNFSKHPALQMVFFLFSLVIYLISLLGNAVRV
SPAFYTPVGYFLSHLSFLDICYMSTTILVMLVNFFQESKTISYEGCLSQIFFLALXSTE
GVLLAAIAYDHCVAICHRLQYRLLMSGKVYVCLVTGFWMCGLLNSGTHTALTATLT//
EPNPISCFLCAIPLLLKLSCSDTCQXC\HVVRATTGLSPCLFMAMSYIFIISTIFGTD
HFNYDRPTEGCSLDTDILVSVLFCVVTPVLNPITYSLRNKEIKGAVMRLTGKHEFSSEVT
D

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 SNP T/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 146,890,784 146,890,784 SNP A/T rs6593778 (DbSNP)
1 146,890,884 146,890,884 SNP A/C rs6657402 (DbSNP)
1 146,891,000 146,891,000 SNP C/T rs11240033 (DbSNP)
1 146,891,144 146,891,144 SNP A/G rs11581799 (DbSNP)
1 146,891,308 146,891,308 SNP C/T rs4590726 (DbSNP)
1 146,891,403 146,891,403 SNP A/T rs4534446 (DbSNP)
1 146,891,408 146,891,408 SNP C/T rs4307607 (DbSNP)
1 146,891,577 146,891,577 SNP C/G rs56257421 (DbSNP)
1 146,891,586 146,891,586 SNP A/C rs11240034 (DbSNP)
1 147,419,157 147,419,157 SNP A/C 1000GP (CEU, CHBJPT)
1 147,419,417 147,419,417 SNP G/A 1000GP (CEU, CHBJPT)
1 147,419,581 147,419,581 SNP C/T 1000GP (CEU, CHBJPT)
1 147,419,676 147,419,676 SNP T/A 1000GP (CEU, CHBJPT)
1 147,419,681 147,419,681 SNP C/T 1000GP (CEU, CHBJPT)
1 147,419,859 147,419,859 SNP C/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
1 145,831,974 147,391,604 Inversion Variation_29494 (DGV)
1 146,884,994 147,083,866 CopyNumber Variation_4253 (DGV)
1 146,890,968 146,891,193 Del(-20) #1(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.