Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR14C36 Olfactory Receptor

Gene Symbol OR14C361 (View this gene in GeneCards)
Family 14
Subfamily C
Pseudogene No
CORP pseudogene probability score 0 (functional)
Aliases HsOR1.5.36
External Ids HGNC: 15026   
Build #39 labels OR5BF1
Chromosomal location 1:248,348,775-248,349,710 (+)
Cluster 1@248
Synteny CLIC#0
Remarks Belongs to OR14- a new family which is expanded in opossum and platypus. Was previously classified into family 5 with the symbol OR5BF1.

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10A2 74.66% 296
OR14A16 50% 304
OR14I1 49.35% 308
OR14J1 46.89% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR14J1B 46% 311
Chimp CONTIG1126.39-5636 96% 312
Mouse Or14c39 61% 305
Rat Or14c39 60% 309
Cow OR14P2 49% 304

Expression evidences

Source Accession
GNF Atlas2 gnf1h10659_at

Sequence information

Nucleotide sequence ATGCCCAATTCAACCACCGTGATGGAATTTCTCCTCATGAGGTTTTCTGATGTGTGGACA
CTACAGATTTTACATTCTGCATCCTTCTTTATGTTGTATTTGGTAACTCTAATGGGAAAC
ATCCTCATTGTGACCGTCACCACCTGTGACAGCAGCCTTCACATGCCCATGTACTTCTTC
CTCAGGAATCTGTCTATCTTGGATGCCTGCTACATTTCTGTTACAGTCCCTACCTCATGT
GTCAATTCCCTACTGGACAGCACCACCATTTCTAAGGCGGGATGTGTAGCTCAGGTCTTC
CTCGTGGTTTTTTTTGTATATGTGGAGCTTCTGTTTCTCACCATTATGGCTCATGACCGC
TATGTGGCTGTCTGCCAGCCACTTCACTACCCTGTGATCGTGAACTCTCGAATCTGCATC
CAGATGACACTGGCCTCCCTACTCAGTGGTCTTGTCTATGCAGGCATGCACACTGGCAGC
ACATTCCAGCTGCCCTTCTGTCGGTCCAACGTTATTCATCAATTCTTCTGTGACATCCCC
TCTCTGCTGAAGCTCTCTTGCTCTGACACCTTCAGCAATGAGGTCATGATTGTTGTCTCT
GCTCTGGGGGTAGGTGGCGGCTGTTTCATCTTTATCATCAGGTCTTACATTCACATCTTT
TCGACCGTGCTCGGGTTTCCAAGAGGAGCAGACAGAACAAAGGCCTTTTCCACCTGCATC
CCTCACATCCTGGTGGTGTCAGTCTTCCTCAGTTCATGCTCTTCTGTGTACCTCAGGCCA
CCTGCGATACCTGCAGCCACCCAGGATCTGATCCTTTCTGGTTTTTATTCCATAATGCCT
CCCCTCTTTAACCCTATTATTTACAGTCTTAGAAATAAGCAAATAAAGGTGGCCATCAAG
AAAATCATGAAGAGAATTTTTTATTCAGAAAATGTG
Conceptual translation MPNSTTVMEFLLMRFSDVWTLQILHSASFFMLYLVTLMGNILIVTVTTCDSSLHMPMYFF
LRNLSILDACYISVTVPTSCVNSLLDSTTISKAGCVAQVFLVVFFVYVELLFLTIMAHDR
YVAVCQPLHYPVIVNSRICIQMTLASLLSGLVYAGMHTGSTFQLPFCRSNVIHQFFCDIP
SLLKLSCSDTFSNEVMIVVSALGVGGGCFIFIIRSYIHIFSTVLGFPRGADRTKAFSTCI
PHILVVSVFLSSCSSVYLRPPAIPAATQDLILSGFYSIMPPLFNPIIYSLRNKQIKVAIK
KIMKRIFYSENV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS A/G Q/R 1000GP (YRI, YRI, YRI, YRI)
1 100 -100 SYN C/T T/T 1000GP (YRI, YRI, YRI)
1 248,348,792 248,348,792 SYN C/T T/T 1000GP (CEU, CHBJPT)
1 248,349,196 248,349,196 NS A/G Q/R 1000GP (CEU, CHBJPT)
1 248,349,335 248,349,335 SYN C/T C/C 1000GP (CEU, CHBJPT)
1 248,349,447 248,349,447 NS G/A G/R 1000GP (CEU, CHBJPT)
1 248,349,465 248,349,465 NS G/T D/Y 1000GP (CEU, CHBJPT)
1 248,512,094 248,512,094 SNP C/T rs28728105 (DbSNP)
1 248,512,498 248,512,498 SNP A/G rs28448343 (DbSNP)
1 248,512,637 248,512,637 SNP T/C rs2039824 (DbSNP)
1 248,512,684 248,512,684 SNP C/G rs62621369 (DbSNP)
1 248,512,749 248,512,749 SNP A/G rs28377739 (DbSNP)
1 248,512,767 248,512,767 SNP G/T rs28545014 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q141R G225R D231Y R305I % Freq CORP
1 Q R Y R 41.55 0.021
2 Q G D R 33.41 0.021
3 R G D R 22.81 0.021
4 Q R Y I 1.77 0.021
5 R G Y R 0.15 0.021
6 R R Y R 0.15 0.021
7 Q G D I 0.08 0.021
8 R R D R 0.08 0.021

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5BF1.aApr07-unspliced main_exon CDS chr1 248,348,775 248,349,710 +
3UTR chr1 248,349,710 248,349,713 +