Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1E3P Olfactory Receptor

Gene Symbol OR1E3P1 (View this gene in GeneCards)
Family 1
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR17-7, OR17-210, HsOR17.1.3P, ORL3749
External Ids HGNC: 8191   GeneBank: AF087929, AF399437, AF546350-AF546363, BK004549, HSU04690, NG_002151   ORDB: ORL3749   
Build #39 labels OR1E3P
Chromosomal location 17:3,116,427-3,117,403 (+)
Cluster 17@3b
Synteny CLIC#39
Remarks Segregating Pseudo Gene, a polymorphism of C->del at position 54 (rs11377766)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1E1 77.24% 312
OR1E2 74.22% 322

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1E1 76% 309
Chimp CONTIG2961.2-15557 94% 326
Mouse Or1e1c 76% 297
Rat Or1e18 75% 298
Cow OR1E1G 75% 312

Expression evidences

Source Accession
GNF Atlas2 217224_at

Sequence information

Nucleotide sequence ATGATGAAGAAGAACCAAACCATGATCTCAGAGTTCCTGCTCCTGGGCCTTCCATCCAAC
CTGAGCAGCAGAATCTGTTCTATGCCTTGTTCTTGGCCGTGTATCTTACCACCCTCCTGG
GGAACCTCCTCGTCATTGTCCTCATTCGACTGGACTCCCACCTCCACATGCCTATGTATT
TGTGTCTCAGCAACTTGTCCTTCTCTGACCTCTGCTTTTCCTCGGTCACAATGCCCAAAT
TGCTGCAGAACATGCAGAGCCAAAACCCATCCATCCCCTTTGCGGACTGCCTGGCTCAGA
TGTACTTTCATCTGTTTTATGGAGTTCTGGAGAGCTTCCTCCTTGTGGTCATGGCTTATC
ACTGCTATGTGGCTATTTGCTTTCCTCTGCACTACACCACTATCATGAGCCCCAAGTGTT
GCCTTGGTCTGCTGACACTCTCCTGGCTGTTGACCACTGCCCATGCCACGTTGCACACCT
TGCTTATGGCCAGGCTGTCCTTTTGTGCTGAGAATGTGATTCCTCACTTTTTCTGTGATA
CATCTACCTTGTTGAAGCTGGCCTGCTCCAACACGCAAGTCAATGGGTGGGTGATGTTTT
TCATGGGCGGGCTCATCCTTGTCATCCCATTCCTACTCCTCATCATGTCCTGTGCAAGAA
TCGTCTCCACCATCCTCAGGGTCCCTTCCACTGGGGGCATCCAGAAGGCTTTCTCCACCT
GTGGCCCCCACCTCTCTGTGGTGTCTCTCTTCTATGGGACAATTATTGGTCTCTACTTGT
GCCCATTGACGAATCATAACACTGTGAAGGACACTGTCATGGCTGTGATGTACACTGGGG
TGACCCACATGCTGAACCCCTTCATCTACAGCCTGAGGAACAGAGACATGAGGGGGAACC
CTGGGCAGAGTCTTCAGCACAAAGAAAATTTTTTTGTCTTTAAAATAGTAATAGTTGGCA
TTTTACCGTTATTGAAT
Conceptual translation MMKKNQTMISEFLLLGL/IQPEQQNLFYALFLAVYLTTLLGNLLVIVLIRLDSHLHMPM
YLCLSNLSFSDLCFSSVTMPKLLQNMQSQNPSIPFADCLAQMYFHLFYGVLESFLLVVMA
YHCYVAICFPLHYTTIMSPKCCLGLLTLSWLLTTAHATLHTLLMARLSFCAENVIPHFFC
DTSTLLKLACSNTQVNGWVMFFMGGLILVIPFLLLIMSCARIVSTILRVPSTGGIQKAFS
TCGPHLSVVSLFYGTIIGLYLCPLTNHNTVKDTVMAVMYTGVTHMLNPFIYSLRNRDMRG
NPGQSLQHKENFFVFKIVIVGILPLLN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,019,775 3,019,774 Ins(1) -/C rs72217858 (DbSNP)
17 3,020,337 3,020,336 Ins(1) -/C rs34961330 (DbSNP)
17 3,019,773 3,019,772 Ins(1) -/C rs66950405 (DbSNP)
17 3,019,774 3,019,773 rescued_Ins(1) -/C rs11377766 (DbSNP)
17 3,019,819 3,019,819 SNP A/G rs7213575 (DbSNP)
17 3,019,790 3,019,790 SNP A/G rs769433 (DbSNP)
17 3,020,421 3,020,421 SNP C/G rs61733523 (DbSNP)
17 3,020,147 3,020,147 SNP C/G rs73976796 (DbSNP)
17 3,020,142 3,020,142 SNP C/T rs61732249 (DbSNP)
17 3,020,003 3,020,003 SNP C/T rs61734764 (DbSNP)
17 3,019,881 3,019,881 SNP C/T rs7214748 (DbSNP)
17 3,019,725 3,019,725 SNP C/T rs6502692 (DbSNP)
17 3,020,652 3,020,652 SNP C/T rs2001009 (DbSNP)
17 3,116,431 3,116,431 SNP T/C 1000GP (CEU)
17 3,116,496 3,116,496 SNP A/G 1000GP (CEU, CHBJPT)
17 3,116,525 3,116,525 SNP G/A 1000GP (CEU)
17 3,116,587 3,116,587 SNP C/T 1000GP (CEU)
17 3,116,848 3,116,848 SNP C/T 1000GP (CEU)
17 3,117,358 3,117,358 SNP T/C 1000GP (CEU)
17 3,117,393 3,117,393 SNP C/T 1000GP (CEU)
17 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
17 3,018,447 3,159,865 CopyNumber Variation_2217 (DGV)
17 3,009,955 3,022,970 CopyNumber Variation_49839 (DGV)
17 3,019,621 3,022,697 CopyNumber #97 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.