Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1F1 Olfactory Receptor

Gene Symbol OR1F11 (View this gene in GeneCards)
Family 1
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.36 (functional)
Aliases OR16-35, OR16-36, OR16-36, OR16-37, OR16-37, OR16-4, OR3-145, OR16-90, OR16-90, OLFMF, OR16-88, OR16-88, OR16-89, HsOR16.1.1, ORL1023
External Ids HGNC: 8194   GeneBank: AB065907, AF399559, BC069335, BK004247, HSOLFMF, NM_012360, U86234-U86237, U86239   ORDB: ORL1023   
Build #39 labels OR1F1, OR1F10, OR1F13P
Chromosomal location 16:3,204,247-3,205,182 (+)
Cluster 16@3
Synteny CLIC#38
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs769427)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1F2P 81.31% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1F14P 79% 306
Chimp CONTIG904.61-2336 96% 312
Mouse Or1f19 74% 306
Rat Or1f33 80% 312
Cow OR1F1 84% 312
Cow OR1F1BP 84% 305
Cow OR1F1C 83% 279

Expression evidences

Source Accession
mRNA Y14442
GNF Atlas2 221402_at

Sequence information

Nucleotide sequence ATGAGCGGGACAAACCAGTCGAGTGTCTCCGAGTTCCTCCTCCTGGGACTCTCCAGGCAG
CCCCAGCAGCAGCATCTCCTCTTTGTGTTCTTCCTCAGCATGTACCTGGCCACTGTCCTG
GGGAACCTGCTCATCATCCTGTCCGTAAGCATAGACTCCTGCCTGCACACCCCCATGTAC
TTCTTCCTCAGCAACCTGTCTTTTGTGGACATCTGCTTCTCCTTCACCACCGTCCCCAAG
ATGCTGGCCAATCACATACTCGAGACTCAGACCATCTCCTTCTGTGGCTGTCTCACACAG
ATGTATTTCGTTTTCATGTTCGTGGACATGGACAATTTCCTCCTAGCTGTGATGGCCTAT
GACCACTTTGTCGCCGTGTGCCACCCCTTACATTACACAGCAAAGATGACCCATCAGCTC
TGTGCCCTGCTGGTTGCTGGATTATGGGTGGTTGCCAACCTGAATGTCCTTCTGCACACC
CTGCTGATGGCTCCACTCTCATTCTGTGCAGACAATGCCATCACTCACTTCTTCTGCGAT
GTGACTCCCCTACTGAAACTCTCCTGCTCAGACACACACCTCAATGAGGTCATAATCCTT
AGTGAGGGTGCCCTGGTCATGATCACCCCATTTCTTTGCATCCTGGCTTCTTATATGCAC
ATCACCTGCACTGTCCTGAAGGTCCCATCCACAAAGGGAAGGTGGAAAGCCTTCTCCACC
TGTGGTTCTCACCTGGCTGTGGTTCTCCTCTTCTACAGCACCATCATTGCTGTGTATTTT
AACCCTCTGTCCTCCCACTCAGCTGAGAAAGACACTATGGCTACTGTGTTGTATACAGTA
GTGACTCCCATGCTAAACCCTTTCATCTACAGCCTGAGGAACAGGTACTTGAAAGGGGCT
CTGAAAAAAGTAGTTGGCAGGGTGGTGTTTTCTGTC
Conceptual translation MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMY
FFLSNLSFVDICFSFTTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAY
DHFVAVCHPLHYTAKMTHQLCALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCD
VTPLLKLSCSDTHLNEVIILSEGALVMITPFLCILASYMHITCTVLKVPSTKGRWKAFST
CGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGA
LKKVVGRVVFSV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
16 100 -100 NS T/C Y/H 1000GP (YRI, YRI, YRI, YRI, YRI)
16 100 -100 SYN C/T S/S 1000GP (YRI, YRI)
16 3,204,418 3,204,418 NS C/G P/A 1000GP (CEU)
16 3,204,470 3,204,470 NS T/C F/S 1000GP (CEU, CHBJPT)
16 3,204,972 3,204,972 SYN T/C G/G 1000GP (CEU, CHBJPT)
16 3,254,418 3,254,418 NS C/G P/A rs61731432 (DbSNP)
16 3,254,424 3,254,424 NS C/T H/Y rs61731433 (DbSNP)
16 3,254,428 3,254,428 NS C/T S/F rs61731434 (DbSNP)
16 3,254,470 3,254,470 NS T/C F/S rs1834026 (DbSNP)
16 3,254,566 3,254,566 NS C/T S/F rs61731435 (DbSNP)
16 3,254,611 3,254,611 NS A/G H/R rs61731440 (DbSNP)
16 3,254,622 3,254,622 NS A/G M/V rs8045183 (DbSNP)
16 3,254,783 3,254,783 NS C/G C/W rs61731438 (DbSNP)
16 3,254,972 3,254,972 SYN C/T G/G rs2075851 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
16 3,202,782 3,309,413 CopyNumber Variation_4921 (DGV)
16 3,254,147 3,257,182 CopyNumber #95 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L14F P58A Y60H F75S E88K H122R V126M C179W T209N % Freq CORP
1 L P Y F E H V C T 54.22 0.602
2 L P Y S E H V C T 38.40 0.602
3 L P Y S E H M C T 3.53 0.936
4 L A Y S E H V C T 1.23 0.763
5 L P Y F E R V C T 1.23 0.078
6 L P H F E H V C T 0.77 0.958
7 L P Y S E H V C N 0.23 0.602
8 L P H F E R V C T 0.15 0.562
9 F P Y F E H V C T 0.08 0.602
10 L P Y F E H V W T 0.08 0.865
11 L P Y F K H V C T 0.08 0.602

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1F1.aApr07-unspliced main_exon CDS chr16 3,204,247 3,205,182 +
3UTR chr16 3,205,182 3,205,188 +