Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1J4 Olfactory Receptor

Gene Symbol OR1J41 (View this gene in GeneCards)
Family 1
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.32 (functional)
Aliases HSHTPCRX01, OR9-21, HsOR9.6.3, ORL38
External Ids HGNC: 8211   GeneBank: AB065718, AF399553, BK004469, HSHTPRX01, NM_001004452   ORDB: ORL38   
Build #39 labels OR1J4
Chromosomal location 9:122,519,141-122,520,079 (+)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1J1 74.84% 306
OR1J2 77.88% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1J6P 69% 307
Chimp CONTIG771.57-59256 78% 312
Chimp CONTIG771.57-25379 76% 306
Chimp CONTIG771.57-67285 99% 230
Mouse Or1j4 80% 310
Rat Or1j4 81% 310
Cow OR1J4 83% 313
Cow OR1J4C 82% 313
Cow OR1J4B 81% 313
Cow OR1J4D 81% 313

Expression evidences

Source Accession
mRNA AB529305
GNF Atlas2 gnf1h07003_at

Sequence information

Nucleotide sequence ATGAAGAGGGAGAATCAGAGCAGTGTGTCTGAGTTCCTCCTCCTGGACCTCCCCATCTGG
CCAGAGCAGCAGGCTGTGTTCTTCACCCTGTTCTTGGGCATGTACCTGATCACGGTGCTG
GGGAACCTGCTCATCATCCTGCTCATCCGGCTGGACTCTCACCTTCACACCCCCATGTTC
TTCTTCCTCAGCCACTTGGCTCTCACTGACATCTCCCTTTCATCTGTCACTGTCCCAAAG
ATGTTATTAAGCATGCAAACTCAGGATCAATCCATTCTTTATGCAGGGTGTGTAACTCAG
ATGTATTTTTTCATATTTTTCACTGATCTAGACAATTTCCTTCTCACTTCAATGGCATAC
GATCGGTATGTGGCCATCTGTCACCCCCTCCGCTACACCACTATCATGAAAGAGGGACTG
TGTAACTTACTAGTCACTGTGTCCTGGATCCTCTCCTGTACCAATGCCCTGTCTCACACT
CTCCTCCTGGCCCAGCTGTCCTTTTGTGCTGACAACACCATCCCCCATTTCTTCTGTGAT
CTTGTTGCCCTACTCAAGCTCTCATGCTCAGACATCTCCCTCAATGAGCTGGTCATTTTC
ACAGTGGGACAGGCAGTCATTACTCTACCACTAATATGCATCTTGATCTCTTATGGCCAC
ATTGGGGTCACCATCCTCAAGGCTCCATCTACTAAGGGCATCTTCAAAGCTTTGTCCACC
TGTGGCTCTCACCTCTCTGTGGTGTCTCTGTATTATGGCACAATTATTGGACTGTATTTT
CTCCCCTCATCCAGTGCCTCCAGTGACAAGGACGTAATTGCCTCTGTGATGTACACGGTG
ATCACCCCATTGCTGAATCCCTTCATTTATAGCCTAAGGAACAGGGACATAAAGGGAGCC
CTGGAGAGACTCTTCAACAGGGCAACAGTCTTATCTCAA
Conceptual translation MKRENQSSVSEFLLLDLPIWPEQQAVFFTLFLGMYLITVLGNLLIILLIRLDSHLHTPMF
FFLSHLALTDISLSSVTVPKMLLSMQTQDQSILYAGCVTQMYFFIFFTDLDNFLLTSMAY
DRYVAICHPLRYTTIMKEGLCNLLVTVSWILSCTNALSHTLLLAQLSFCADNTIPHFFCD
LVALLKLSCSDISLNELVIFTVGQAVITLPLICILISYGHIGVTILKAPSTKGIFKALST
CGSHLSVVSLYYGTIIGLYFLPSSSASSDKDVIASVMYTVITPLLNPFIYSLRNRDIKGA
LERLFNRATVLSQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 SYN C/T Y/Y 1000GP (YRI)
9 122,519,501 122,519,501 NS G/A D/N 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
9 125,281,320 125,284,358 CopyNumber #133 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L140Q T146P L161P % Freq CORP
1 L T L 99.46 0.514
2 Q T L 0.23 0.514
3 L T P 0.23 0.514
4 L P L 0.08 0.514

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1J4.aApr07-unspliced main_exon CDS chr9 122,519,141 122,520,079 +
3UTR chr9 122,520,079 122,520,082 +