Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1N1 Olfactory Receptor

Gene Symbol OR1N11 (View this gene in GeneCards)
Family 1
Subfamily N
Pseudogene No
CORP pseudogene probability score 0.18 (functional)
Aliases OR1-26, OR9-22, HsOR9.6.4, ORL254
External Ids HGNC: 8221   GeneBank: AB065719, AF399547, BK004446, NM_012363, U86216   ORDB: ORL254   
Build #39 labels OR1N1, OR1N3
Chromosomal location 9:122,526,361-122,527,293 (-)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1E1 57.05% 305
OR1M1 56.31% 309
OR1N2 60.13% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1M1B 59% 310
Chimp CONTIG*********** 99% 311
Mouse Or1n1 85% 310
Rat Or1n1 86% 311
Cow OR1N1 85% 311

Expression evidences

Source Accession
mRNA BC156678
GNF Atlas2 gnf1h10674_at

Sequence information

Nucleotide sequence ATGGAAAACCAATCCAGCATTTCTGAATTTTTCCTCCGAGGAATATCAGCGCCTCCAGAG
CAACAGCAGTCCCTCTTCGGAATTTTCCTGTGTATGTATCTTGTCACCTTGACTGGGAAC
CTGCTCATCATCCTGGCCATTGGCTCTGACCTGCACCTCCACACCCCCATGTACTTTTTC
TTGGCCAACCTGTCTTTTGTTGACATGGGTTTAACGTCCTCCACAGTTACCAAGATGCTG
GTGAATATACAGACTCGGCATCACACCATCTCCTATACGGGTTGCCTCACGCAAATGTAT
TTCTTTCTGATGTTTGGTGATCTAGACAGCTTCTTCCTGGCTGCCATGGCGTATGACCGC
TATGTGGCCATTTGCCACCCCCTCTGCTACTCCACAGTCATGAGGCCCCAAGTCTGTGCC
CTAATGCTTGCATTGTGCTGGGTCCTCACCAATATCGTTGCCCTGACTCACACGTTCCTC
ATGGCTCGGTTGTCCTTCTGTGTGACTGGGGAAATTGCTCACTTTTTCTGTGACATCACT
CCTGTCCTGAAGCTGTCATGTTCTGACACCCACATCAACGAGATGATGGTTTTTGTCTTG
GGAGGCACCGTACTCATCGTCCCCTTTTTATGCATTGTCACCTCCTACATCCACATTGTG
CCAGCTATCCTGAGGGTCCGAACCCGTGGTGGGGTGGGCAAGGCCTTTTCCACCTGCAGT
TCCCACCTCTGCGTTGTTTGTGTGTTCTATGGGACCCTCTTCAGTGCCTACCTGTGTCCT
CCCTCCATTGCCTCTGAAGAGAAGGACATTGCAGCAGCTGCAATGTACACCATAGTGACT
CCCATGTTGAACCCCTTTATCTATAGCCTAAGGAACAAGGACATGAAGGGGGCCCTAAAG
AGGCTCTTCAGTCACAGGAGTATTGTTTCCTCT
Conceptual translation MENQSSISEFFLRGISAPPEQQQSLFGIFLCMYLVTLTGNLLIILAIGSDLHLHTPMYFF
LANLSFVDMGLTSSTVTKMLVNIQTRHHTISYTGCLTQMYFFLMFGDLDSFFLAAMAYDR
YVAICHPLCYSTVMRPQVCALMLALCWVLTNIVALTHTFLMARLSFCVTGEIAHFFCDIT
PVLKLSCSDTHINEMMVFVLGGTVLIVPFLCIVTSYIHIVPAILRVRTRGGVGKAFSTCS
SHLCVVCVFYGTLFSAYLCPPSIASEEKDIAAAAMYTIVTPMLNPFIYSLRNKDMKGALK
RLFSHRSIVSS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS C/T R/Q 1000GP (YRI, YRI)
9 100 -100 SYN G/A S/S 1000GP (YRI, YRI, YRI)
9 122,526,614 122,526,614 NS C/T R/Q 1000GP (CHBJPT)
9 122,526,754 122,526,754 SYN A/G T/T 1000GP (CEU)
9 122,526,804 122,526,804 SYN A/G L/L 1000GP (CEU, CHBJPT)
9 122,527,242 122,527,242 NS G/A P/S 1000GP (CEU, CHBJPT)
9 122,527,243 122,527,243 SYN C/T A/A 1000GP (CEU)
9 125,288,893 125,288,893 NS C/T R/Q rs58226717 (DbSNP)
9 125,289,033 125,289,033 SYN A/G T/T rs41277122 (DbSNP)
9 125,289,083 125,289,083 SYN A/G L/L rs16911867 (DbSNP)
9 125,289,224 125,289,223 Ins(1) -/C rs35753722 (DbSNP)
9 125,289,521 125,289,521 NS A/G S/P rs10818708 (DbSNP)
9 125,289,522 125,289,523 In-Del(2) AT/C/GC/T rs13287449 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
9 125,286,640 125,289,672 CopyNumber #115 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R229H R227Q Y58N P18S % Freq CORP
1 R R Y S 54.99 0.340
2 R R Y P 32.10 0.340
3 R Q Y S 12.67 0.340
4 R R N S 0.15 0.887
5 H R Y P 0.08 0.340

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1N1.aApr07-unspliced main_exon 3UTR chr9 122,526,358 122,526,361 -
CDS chr9 122,526,361 122,527,293 -