Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1Q1 Olfactory Receptor

Gene Symbol OR1Q11 (View this gene in GeneCards)
Family 1
Subfamily Q
Pseudogene No
CORP pseudogene probability score
Aliases hRPK-465_F_21, OR9-25, OR9-A, HSTPCR106, OST226, HsOR9.6.8, ORL3243
External Ids HGNC: 8223   GeneBank: AB065722, AF399561, BK004228, HSTPCR106, NM_012364   ORDB: ORL3243   
Build #39 labels OR1Q1
Chromosomal location 9:122,614,738-122,615,679 (+)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1L1 51.78% 309
OR1L4 52.1% 309
OR1L6 52.65% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7D4 43% 310
Chimp CONTIG904.61-2336 54% 308
Chimp CONTIG*********** 53% 309
Chimp CONTIG291.320-3384 53% 302
Mouse Or1q1 56% 307
Rat Or1q1 55% 307
Cow OR1Q1 80% 314

Expression evidences

Source Accession
ESTs AI827216
mRNA X89667
GNF Atlas2 gnf1h07004_at

Sequence information

Nucleotide sequence ATGGACAACAGCAACTGGACCAGTGTGTCCCATTTTGTTCTCTTGGGCATTTCCACCCAC
CCAGAAGAGCAAATCCCACTCTTCCTTGTTTTCTCACTCATGTACGCAATCAATATTTCT
GGCAACTTGGCCATCATCACACTGATTCTCTCTGCTCCACGCCTCCACATCCCCATGTAC
ATCTTCCTCAGTAACTTGGCCTTGACAGACATCTGCTTCACCTCCACCACGGTCCCCAAG
ATGCTGCAGATTATTTTCTCCCCTACAAAGGTAATTTCCTACACAGGCTGTTTAGCCCAA
ACTTATTTCTTCATTTGCTTCGCCGTCATGGAAAACTTCATCCTGGCTGTGATGGCCTAT
GACAGGTACATTGCCATCTGCCACCCTTTCCACTACACTATGATCCTGACTAGAATGCTG
TGTGTGAAGATGGTGGTCATGTGCCATGCTCTCTCCCACCTTCATGCCATGCTGCATACC
TTTCTCATAGGCCAACTAATCTTCTGTGCAGATAACAGAATCCCCCACTTCTTCTGTGAC
CTCTACGCTCTGATGAAGATCTCCTGCACCAGCACCTACCTCAACACCCTTATGATTCAC
ACAGAAGGTGCTGTTGTAATCAGTGGAGCTCTGGCCTTCATTACTGCCTCCTATGCCTGC
ATCATCCTGGTGGTCCTCCGGATCCCCTCAGCCAAGGGCAGGTGGAAAACCTTTTCTACC
TGCGGCTCCCACCTCACTGTGGTGGCCATATTCTATGGCACCCTCAGTTGGGTCTACTTC
CGGCCCCTTTCCAGCTATTCAGTGACCAAGGGTCGCATTATAACAGTCGTGTACACAGTG
GTGACTCCCATGCTGAACCCCTTCATCTACAGCCTGAGGAATGGGGATGTCAAGGGAGGC
TTCATGAAATGGATGAGCAGAATGCAGACTTTTTTCTTTAGA
Conceptual translation MDNSNWTSVSHFVLLGISTHPEEQIPLFLVFSLMYAINISGNLAIITLILSAPRLHIPMY
IFLSNLALTDICFTSTTVPKMLQIIFSPTKVISYTGCLAQTYFFICFAVMENFILAVMAY
DRYIAICHPFHYTMILTRMLCVKMVVMCHALSHLHAMLHTFLIGQLIFCADNRIPHFFCD
LYALMKISCTSTYLNTLMIHTEGAVVISGALAFITASYACIILVVLRIPSAKGRWKTFST
CGSHLTVVAIFYGTLSWVYFRPLSSYSVTKGRIITVVYTVVTPMLNPFIYSLRNGDVKGG
FMKWMSRMQTFFFR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS A/G Q/R 1000GP (YRI, YRI, YRI, YRI, YRI)
9 100 -100 SYN C/T D/D 1000GP (YRI, YRI)
9 122,614,808 122,614,808 NS A/G Q/R 1000GP (CEU, CHBJPT)
9 122,615,226 122,615,226 NS A/G I/M 1000GP (CEU, CHBJPT)
9 122,615,261 122,615,261 NS C/T P/L 1000GP (CEU)
9 122,615,455 122,615,455 NS A/G T/A 1000GP (CEU, CHBJPT)
9 125,377,022 125,377,022 SYN C/T D/D rs16911955 (DbSNP)
9 125,377,087 125,377,087 NS G/A R/Q rs972925 (DbSNP)
9 125,377,223 125,377,223 SYN A/C T/T rs10985733 (DbSNP)
9 125,377,505 125,377,505 NS G/A M/I rs1329957 (DbSNP)
9 125,377,540 125,377,540 NS C/T P/L rs55957445 (DbSNP)
9 125,377,734 125,377,734 NS A/G T/A rs727913 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
9 125,376,917 125,379,958 CopyNumber #117 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q24R I37T Y120C P175L A183T T240A % Freq CORP
1 R I Y P A T 67.97 0.034
2 Q I Y P A T 19.66 0.034
3 R I Y P A A 10.75 0.114
4 R I Y P T T 0.84 0.034
5 R I C P A A 0.23 0.114
6 R I Y L A T 0.23 0.034
7 Q T Y P A T 0.23 0.034
8 R I C P A T 0.08 0.034

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1J2andOR1Q1.aApr07-unspliced main_exon CDS chr9 122,614,738 122,615,679 +
3UTR chr9 122,615,679 122,615,682 +
OR1J2andOR1Q1.eApr07 exon_5UTR chr9 122,610,032 122,610,050 +
main_exon CDS_partial chr9 122,614,738 122,615,007 +
exon_3UTR chr9 122,619,360 122,619,567 +
exon_3UTR chr9 122,620,448 122,620,515 +
exon_3UTR chr9 122,637,106 122,637,236 +
exon_3UTR chr9 122,639,598 122,639,685 +