Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A5 Olfactory Receptor

Gene Symbol OR2A51 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR7-138, OR7-138, OR7-141, OR7-141, HsOR7.6.10, ORL396, ORL272
External Ids HGNC: 8232   GeneBank: AF399595, NM_012365, U86278, U86281   ORDB: ORL396, ORL272   
Build #39 labels OR2A5, OR2A26
Chromosomal location 7:144,050,402-144,051,334 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A20P 80.84% 308
OR2A42 80.19% 308
OR2A9P 80.84% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A5 89% 310
Chimp CONTIG4416.3-432 98% 303
Mouse Or2a5 87% 311
Rat Or2a5 86% 311
Rat Or2a14 81% 309
Cow OR2A5 88% 309

Expression evidences

Source Accession
mRNA BC136860

Sequence information

Nucleotide sequence ATGACAAAAAATCAGACATGGGTCACAGAATTCATTCTCCTGGGATTTCCACTCAGCCTA
AGGATTCAGATGCTCCTCTCTGGGCTTTTCTCCCTGTTATACGTCTTCACCCTGCTGGGA
AATGGGGCCATCCTGGGGCTCATCTGGCTGGACTCCAGACTGCACACCCCCATGTACTTC
TTTCTCTCACACCTGGCCATCATTGATATTTCGTATGCTTCCAACAATGTCCCCAAGATG
CTGACAAACCTTGGCTTGAACAAGAGAAAAACAATCTCCTTTGTCCCATGCACAATGCAG
ACCTTTTTATACATGGCTTTTGCTCACACTGAGTGTCTCATCTTGGTAATGATGTCCTAC
GATCGGTACATGGCTATCTGCCACCCTCTGCAATATTCTGTCATCATGAGATGGGGAGTG
TGCACAGTCCTGGCTGTCACTTCTTGGGCATGTGGTTCCCTTCTGGCCCTGGTCCATGTG
GTTCTCATCCTGAGGCTGCCCTTCTGTGGGCCCCATGAAATCAACCACTTCTTCTGTGAA
ATCCTGTCTGTCCTCAAGTTGGCCTGTGCTGACACCTGGCTCAACCAGGTGGTCATCTTT
GCTGCTTCAGTGTTCATCCTGGTGGGGCCGCTCTGCCTGGTGCTGGTCTCCTACTCGCGC
ATCCTGGCGGCCATCTTGAGGATCCAGTCTGGGGAGGGCCGCAGAAAGGCCTTCTCCACC
TGCTCCTCCCACCTTTGCATGGTGGGACTCTTCTTTGGCAGCGCCATTGTCATGTACATG
GCCCCCAAGTCCCGCCACCCTGAGGAGCAGCAGAAGGTCCTTTCCCTGTTTTACAGCCTT
TTCAACCCGATGCTGAACCCCTTGATCTATAGCCTGAGGAACGCAGAGGTCAAGGGTGCC
CTGAAAAGAGTGTTGTGGAAACAGAGATCAAAG
Conceptual translation MTKNQTWVTEFILLGFPLSLRIQMLLSGLFSLLYVFTLLGNGAILGLIWLDSRLHTPMYF
FLSHLAIIDISYASNNVPKMLTNLGLNKRKTISFVPCTMQTFLYMAFAHTECLILVMMSY
DRYMAICHPLQYSVIMRWGVCTVLAVTSWACGSLLALVHVVLILRLPFCGPHEINHFFCE
ILSVLKLACADTWLNQVVIFAASVFILVGPLCLVLVSYSRILAAILRIQSGEGRRKAFST
CSSHLCMVGLFFGSAIVMYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGA
LKRVLWKQRSK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 NS G/A M/I 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
7 100 -100 SYN G/A L/L 1000GP (YRI, YRI, YRI, YRI)
7 143,747,524 143,747,524 NS A/T E/D rs61739955 (DbSNP)
7 143,747,629 143,747,629 SYN A/G L/L rs61738793 (DbSNP)
7 143,747,796 143,747,796 NS A/C N/T rs61741408 (DbSNP)
7 143,747,799 143,747,799 NS C/T S/F rs61741407 (DbSNP)
7 143,747,870 143,747,870 NS A/G I/V rs2961144 (DbSNP)
7 143,747,952 143,747,952 Del(1) -/C rs35952994 (DbSNP)
7 143,748,098 143,748,098 NS G/T A/S rs6464573 (DbSNP)
7 143,748,257 143,748,257 NS A/G T/A rs6464574 (DbSNP)
7 143,748,364 143,748,364 SYN C/T Y/Y rs4407791 (DbSNP)
7 144,050,777 144,050,777 NS A/G I/V 1000GP (CEU)
7 144,051,005 144,051,005 NS G/T A/S 1000GP (CEU)
7 144,051,164 144,051,164 NS G/A A/T 1000GP (CEU)
7 144,051,271 144,051,271 SYN T/C Y/Y 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)
7 143,572,286 143,866,532 CopyNumber Variation_8581 (DGV)
7 143,742,520 143,847,474 CopyNumber Variation_4570 (DGV)
7 143,747,395 143,750,427 Deletion #194 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M1I E10D T101N F102S I126V E173K A202S A255T % Freq CORP
1 M E T F I E A A 72.20 0.144
2 M E T F V E S T 19.97 0.144
3 M E T F V E S A 2.92 0.144
4 M D T F I E A A 2.00 0.144
5 M E T F V K S A 1.15 0.144
6 I E T F I E A A 0.46 1.200
7 M E T S V E A A 0.38 0.144
8 M E N F I E A A 0.31 0.144
9 M E T F I E S A 0.23 0.144
10 M E T F V E A A 0.15 0.144
11 M E T F V K A A 0.08 0.144
12 M E T F I E S T 0.08 0.144
13 M E T S V E A T 0.08 0.144

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2A5.aApr07-unspliced main_exon CDS chr7 144,050,402 144,051,334 +
3UTR chr7 144,051,334 144,051,337 +