Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A9P Olfactory Receptor

Gene Symbol OR2A9P1 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HSDJ0798C17, OR7-86, OR7-17, HsOR7.6.22P, ORL3203
External Ids HGNC: 8236   GeneBank: AB065477, AB065610, AF399463, AF546392-AF546405, BK004757, NR_002157, NR_002158, U86282   ORDB: ORL3203   
Build #39 labels OR2A9P
Chromosomal location 7:144,299,373-144,300,302 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A20P 100% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A9 86% 310
Dog OR2A9B 85% 310
Mouse Or2a20 81% 310
Rat Or2a20 81% 310
Cow OR2A5 79% 307
Orang OR2A9 91% 310
Orang OR2A42 89% 310
Horse OR2A9 87% 310
Horse OR2A9BP 85% 309
Chimp OR2A42 91% 310

Expression evidences

Source Accession
ESTs W03780
mRNA AB464440

Sequence information

Nucleotide sequence ATGGTGAAAAATCAGACAATGGTCACAGAGTTCCTCCTACTGGGATTTCTCCTGGGCCCA
AGGATTCAGATGCTCCTCTTTGGGCTCTTCTCCCTGTTCTATGTCTTCACCCTGCTGGGG
AATGGGACCATCCTGGGGCTCATCTCACTGGACTCCAGACTCCACACCCCCATGTACTTC
TTCCTCTCACACCTGGCCGTCGTCAACATCGCCTATGCCTGCAACACAGTGCCCCAGATG
CTGGTGAACCTCCTGCATCCAGCCAAGCCCATCTCCTTTGCTGGCTGCATGACATAGACC
TTTCTCTTTTTGAGTTTTGCACATACTGAATGCCTCCTGTTGGTGCTGATGTCCTACGAT
CGGTACGTGGCCATCTGCCACCCTCTCCGATATTTCATCATCATGACCTGGAAAGTCTGC
ATCACTCTGGCCATCACTTCCTGGACATGTGGCTCCCTCCTGGCTATGGTCCATGTGAGC
CTCATCCTAAGACTGCCCTTTTGTGGGCCTCGTGAAATCAACCACTTCTTCTGTGAAATC
CTGTCTGTCCTCAGGCTGGCCTGTGCTGATACCTGGCTCAACCAGGTGGTCATCTTTGCA
GCCTGCATGTTCATCCTGGTGGGACCACTCTGCCTGGTGCTGGTCTCCTACTCACACATC
CTGGCGGCCATCCTGAGGATCCAGTCTGGGGAGGGCCGCAGAAAGGCCTTCTCCACCTGC
TCCTCCCACCTCTGCGTAGTGGGACTCTTCTTTGGCAGCGCCATCGTCATGTACATGGCC
CCTAAGTCCCGCCATCCTGAGGAGCAGCAGAAGGTCCTTTTTCTATTTTACAGTTCTTTC
AACCCGATGCTAAACCCCCTGATTTACAACCTGAGGAATGTAGAGGTCAAGGGTGCCCTG
AGGAGAGCACTGTGCAAGGAAAGTCATTCC
Conceptual translation MVKNQTMVTEFLLLGFLLGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHTPMYF
FLSHLAVVNIAYACNTVPQMLVNLLHPAKPISFAGCMTXFLFLSFAHTECLLLVLMSYD
RYVAICHPLRYFIIMTWKVCITLAITSWTCGSLLAMVHVSLILRLPFCGPREINHFFCEI
LSVLRLACADTWLNQVVIFAACMFILVGPLCLVLVSYSHILAAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSRHPEEQQKVLFLFYSSFNPMLNPLIYNLRNVEVKGAL
RRALCKESHS

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
CopyNumber 159 (Hasin)
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,873,741 144,029,792 Inversion Variation_37282 (DGV)
7 143,877,475 144,074,275 CopyNumber Variation_59622 (DGV)
7 143,877,476 144,074,583 CopyNumber Variation_70058 (DGV)
7 143,878,837 144,073,622 CopyNumber Variation_31398 (DGV)
7 143,879,547 144,073,724 CopyNumber Variation_4571 (DGV)
7 143,887,276 144,027,539 CopyNumber Variation_37567 (DGV)
7 143,905,946 144,059,816 CopyNumber Variation_0726 (DGV), Variation_2110 (DGV)
7 143,945,278 143,999,781 Inversion Variation_59845 (DGV)
7 143,947,032 144,038,091 Inversion Variation_37283 (DGV)
7 143,963,153 144,073,285 CopyNumber Variation_82244 (DGV), Variation_94944 (DGV)
7 143,972,874 144,109,520 Inversion Variation_37284 (DGV)
7 143,993,383 144,034,914 CopyNumber Variation_70057 (DGV)
7 143,994,640 144,030,630 CopyNumber Variation_82245 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.