Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2AJ1 Olfactory Receptor

Gene Symbol OR2AJ11 (View this gene in GeneCards)
Family 2
Subfamily AJ
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR1-52
External Ids HGNC: 15001   GeneBank: AB065626, BK004621, NG_004652   
Build #39 labels OR2AJ1P
Chromosomal location 1:247,933,766-247,934,752 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2L1P 55.02% 309
OR2L2 54.37% 309
OR2L8 55.81% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2AJ7 80% 312
Chimp CONTIG*********** 98% 291
Mouse Or2aj4 79% 314
Rat Or2aj4-ps 80% 316
Cow OR2AJ10P 78% 313

Sequence information

Nucleotide sequence ATGATGGGCCATCAGAATCACACTTTCAGCAGTGATTTCATACTTTTGGGATTGTTCTCT
TCTTCCCCAACAAGTGTGGTCTTCTTCTTAGTTTTATTTGTCATTTTCATTATGAGTGTA
ACAGAAAATACGCTCATGATCCTCCTCATTCGCAGTGACTCCCGACTCCACACTCCAATG
TATTTTCTGCTCAGCCATCTCTCCTTAATGGATATCTTGCATGTTTCCAACATCGTTCCC
AAAATGGTCACTAACTTTCTGTCAGGCAGCAGAACTATTTCATTTGCAGGTTGTGGGTTC
CAGGTATTTCTGTCCCTCACCCTCCTGGGTGGTGAGTGCCTTCTCCTGGCTGCAATGTCC
TGTGATCGCTATGTGGCTATCTGTCACCCGCTGCGCTATCCGATTCTTATGAAGGAGTAT
GCCAGCGCTCTCATGGCTGGAGGCTCCTGGCTCATTGGGGTTTTCAACTCCACAGTCCAC
ACAGCTTATGCACTGCAGTTTCCCTTCTGTGGCTCTAGGGCAATTGATCACTTCTTCTGT
GAAGTCCCTGCCATGTTGAAGTTGTCCTGTGCAGACACAACACGCTATGAACGAGGGGTT
TGTGTAAGTGCTGTGATCTTCCTGCTGATCCCTTTCTCCTTGATCTCTGCTTCTTATGGC
CAAATTATTCTTACTGTCCTCCAGATGAAATCATCAGAGGCAAGGAAAAAGTCATTTTCC
ACTTGTTCCTTCCACATGATTGTGGTCACGATGTACTATGGGCCATTTATTTTTACATAT
ATGAGACCTAAATCATACCACACTCCAGGCCAGGATAAGTTCCTGGCAATATTCTATACG
ATCCTCACACCCACACTCAACCCTTTCATCTACAGCTTTAGGAATAAAGATGTTCTGGCG
GTGATGAAAAATATGCTCAAAAGTAACTTTCTGCACAAAAAAATGAATAGGAAAATTCCT
GAATGTGTGTTCTGTCTATTTCTATGT
Conceptual translation MMGHQNHTFSSDFILLGLFSSSPTSVVFFLVLFVIFIMSVTENTLMILLIRSDSRLHTPM
YFLLSHLSLMDILHVSNIVPKMVTNFLSGSRTISFAGCGFQVFLSLTLLGGECLLLAAMS
CDRYVAICHPLRYPILMKEYASALMAGGSWLIGVFNSTVHTAYALQFPFCGSRAIDHFFC
EVPAMLKLSCADTTRYERGVCVSAVIFLLIPFSLISASYGQIILTVLQMKSSEARKKSFS
TCSFHMIVVTMYYGPFIFTYMRPKSYHTPGQDKFLAIFYTILTPTLNPFIYSFRNKDVLA
VMKNMLKSNFLHKKMNRKIPECVFCLFLC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/T T/M 1000GP (YRI)
1 100 -100 SYN T/C S/S 1000GP (YRI, YRI)
1 247,933,899 247,933,899 NS T/C L/P 1000GP (CHBJPT)
1 247,934,159 247,934,159 NS C/T R/C 1000GP (CEU)
1 248,097,461 248,097,461 NS C/T R/C rs61750766 (DbSNP)
1 248,097,753 248,097,753 NS A/T K/M rs45624439 (DbSNP)
1 248,098,035 248,098,035 NS G/T G/V rs41268443 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,096,968 248,100,054 Deletion #185 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T43M L44P R131C % Freq CORP
1 T L R 97.77 0.997
2 T L C 1.00 0.997
3 M L R 0.84 0.997
4 T P R 0.38 0.997