Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2B2 Olfactory Receptor

Gene Symbol OR2B21 (View this gene in GeneCards)
Family 2
Subfamily B
Pseudogene No
CORP pseudogene probability score
Aliases OR6-2, OR6-1, dJ193B12.4, HsOR6.2.1, ORL681, ORL680, ORL1019
External Ids HGNC: 13966   GeneBank: BK004361, HSA302584-HSA302593, NM_033057   ORDB: ORL681, ORL680, ORL1019   
Build #39 labels OR2B2
Chromosomal location 6:27,911,249-27,912,319 (-)
Cluster 6@28a
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B6 81.61% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B2 87% 313
Chimp CONTIG415.100-2488 98% 357
Mouse Or2b2 86% 313
Mouse Or2b2b 86% 313
Rat Or2b2 84% 310
Cow OR2B2 85% 313
Cow OR2B2D 85% 314

Expression evidences

Source Accession
ESTs N68399
mRNA BC136901
GNF Atlas2 216408_at

Sequence information

Nucleotide sequence ATGAATTGGGTAAATAAGAGTGTCCCACAGGAGTTCATTCTGTTAGTTTTCTCAGATCAA
CCATGGCTAGAGATTCCACCCTTTGTGATGTTTCTGTTTTCCTATATCTTGACAATCTTT
GGCAATCTGACAATAATTCTTGTGTCACATGTGGATTTCAAACTCCACACCCCTATGTAC
TTTTTTCTTAGCAATCTCTCACTCCTGGACCTTTGCTATACCACAAGTACAGTTCCACAA
ATGCTGGTAAACATATGCAACACCAGGAAAGTAATCAGTTATGGTGGCTGTGTGGCCCAG
CTTTTCATTTTCCTGGCCTTGGGTTCCACAGAATGTCTTCTCCTGGCCGTCATGTGCTTT
GATAGGTTTGTAGCTATTTGTCGGCCTCTCCATTACTCAATTATCATGCACCAGAGGCTC
TGCTTCCAGTTGGCAGCTGCATCCTGGATTAGTGGCTTTAGCAATTCAGTATTACAGTCC
ACCTGGACACTTAAGATGCCACTGTGTGGTCACAAAGAAGTGGATCACTTCTTCTGTGAA
GTCCCTGCTCTGCTCAAGTTGTCCTGTGTTGACACAACAGCAAATGAGGCTGAACTATTC
TTCATCAGTGTGCTATTCCTTCTAATACCCGTGACACTCATCCTTATATCGTATGCTTTT
ATTGTCCAAGCAGTGTTGAGAATCCAGTCTGCTGAAGGTCAACGAAAGGCATTTGGGACA
TGTGGCTCCCATCTAATTGTGGTGTCACTTTTTTATGGTACAGCTATCTCCATGTACCTG
CAACCACCTTCACCCAGCTCCAAAGACCGGGGAAAGATGGTTTCTCTCTTCTGTGGAATC
ATTGCACCCATGCTGAATCCCCTTATATATACACTTAGGAACAAAGAGGTAAAGGAAGCC
TTTAAAAGGTTGGTTGCAAAGAGTCTTCTTAATCAAGAAATAAGAAATATGCAAATGATA
AGCTTTGCTAAAGACACAGTGCTTACTTACCTTACTAACTTCTCCGCAAGTTGTCCTATT
TTTGTCATTACTATAGAAAACTATTGTAATCTCCCTCAAAGAAAATTTCCT
Conceptual translation MNWVNKSVPQEFILLVFSDQPWLEIPPFVMFLFSYILTIFGNLTIILVSHVDFKLHTPMY
FFLSNLSLLDLCYTTSTVPQMLVNICNTRKVISYGGCVAQLFIFLALGSTECLLLAVMCF
DRFVAICRPLHYSIIMHQRLCFQLAAASWISGFSNSVLQSTWTLKMPLCGHKEVDHFFCE
VPALLKLSCVDTTANEAELFFISVLFLLIPVTLILISYAFIVQAVLRIQSAEGQRKAFGT
CGSHLIVVSLFYGTAISMYLQPPSPSSKDRGKMVSLFCGIIAPMLNPLIYTLRNKEVKEA
FKRLVAKSLLNQEIRNMQMISFAKDTVLTYLTNFSASCPIFVITIENYCNLPQRKFP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 27,879,200 27,879,200 NS A/C S/A rs34788973 (DbSNP)
6 27,879,982 27,879,982 NS A/G I/T rs61742093 (DbSNP)
6 27,879,551 27,879,551 NS C/G A/P rs9368537 (DbSNP)
6 27,879,397 27,879,397 NS C/T R/Q rs34957169 (DbSNP)
6 27,879,869 27,879,869 NS G/T P/T rs35712782 (DbSNP)
6 27,879,093 27,879,093 SYN A/G S/S rs73392698 (DbSNP)
6 27,911,773 27,911,773 NS C/G A/P 1000GP (CEU, CHBJPT)
6 27,911,619 27,911,619 NS T/C Q/R 1000GP (CEU)
6 27,911,422 27,911,422 NS C/A A/S 1000GP (CEU)
6 27,912,204 27,912,204 NS A/G I/T 1000GP (CEU)
6 27,911,670 27,911,670 NS G/A S/L 1000GP (CHBJPT)
6 100 -100 SYN G/A S/S 1000GP (YRI)
6 100 -100 NS T/C Q/R 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 68 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y348F A300S R270Q Q234R S217L A183P T77P S76G I39T % Freq CORP
1 Y A R Q S A T S I 87.17 0.449
2 Y A R Q S P T S I 4.61 0.449
3 Y S R Q S A T S T 3.61 0.449
4 Y A R R S A T S I 3.07 0.449
5 Y A R Q L P T S I 0.38 0.707
6 Y A R Q S A P S I 0.38 0.449
7 F A R Q S A T S I 0.31 0.449
8 Y A Q Q S A T S I 0.23 0.449
9 Y S R Q S A T S I 0.15 0.449
10 Y A R Q S A T G I 0.08 0.449

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2B2.aApr07-unspliced main_exon 3UTR chr6 27,911,246 27,911,249 -
CDS chr6 27,911,249 27,912,319 -
5UTR chr6 27,912,319 27,912,558 -