Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2B4P Olfactory Receptor

Gene Symbol OR2B4P1 (View this gene in GeneCards)
Family 2
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases AL050339-A, dJ974I11.1, hs6M1-22, HsOR6.3.15P, ORL3170
External Ids HGNC: 8239   GeneBank: AB065472, AF399496, NG_004686   ORDB: ORL3170   
Build #39 labels OR2B4P
Chromosomal location 6:29,290,696-29,291,650 (+)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B2 64.71% 306
OR2B3 61.69% 308
OR2B6 61.74% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B2 67% 308
Mouse Or2b4 91% 314
Rat Or2b4 91% 314
Cow OR2B4 90% 314
Orang OR2B6 63% 312
Horse OR2B4B 91% 319
Horse OR2B4 91% 317
Horse OR2B4C 89% 314
Chimp OR2B2P 63% 311

Expression evidences

Source Accession
GNF Atlas2 208098_at

Sequence information

Nucleotide sequence CCTCCCAGTGCTAACATGTGGATCAACAATCAAAGCTCGCTAGATGATTTTATCCTATTG
GGATTTTCTGACCGTCCCTGGCTAGAGACACCCCTCTGTAATCTTTCTGGTGGCCTACAT
CTTTTCCCTATTTGGAAATATCTCCATTATCCTAGTTTCCCATCTGGATCCCCAGCTTGA
CAGTCCCATGTACTTTTTTGTCTCTAATCTATCCTTTCTGGACCTCTGCTATACCACCAG
CACTGTCCCACAGATGCTGGTCAACCTCCGGGGACCAGAAAAGACCATTAGCTATGGGGG
TTGTGTTGCCCAACTCTATATATTTTTGGCCCTGGGTTCTACTGAATGCATACTTCTAGC
CATCATGGCCTTTGACCGTTACGCTGCCATATGCAAGCCCCTTCACTACCCAGTCATCAT
GAACCATAGACGCTGTATCCACATGGCTGCTGGCACTTGGATCAGTGGCTTTGCTAACTC
CCTTGTCCAGTCCACTCTCACAGTGGTGGCCCCAAGATGTGGACAGAGGGTGTTGGACCA
TTTCTTCTGTGAAGTTCCAGCCCTTTTGAAACTAGCCTGTATTGATATTCGTGTGAATGA
AATGGAGCTCAATGTACTAGGCGCTTTGCTTCTCCTGATGCCACTCACCCTCATCCTGGG
CACTTATGTGTTCATTGCTCAGGCAGTAATGAGAATCTGCTCTGCTGAAAGTCGCTGGAA
GGCTTTCAATACCTGTGCCTCACATTTGCTGGTGGTCTCCCTCTTCTACTTCACAGCCAT
CAGTATGTATGTCCAGCCTCCCTCTAGCTATTCTCATGACCGGGGGAAGATCATGGCTCT
CTTTTATGGCATTGTCACACCCACCCTCAACCCATTCATCTACACATTGAGAAACAAGGA
TGTGAAAGCTGCCCTGAGAAGGTCACTGACTAAAGAGTTTTGGATTAAGACAAGA
Conceptual translation PPSANMWINNQSSLDDFILLGFSDRPWLETPL\IFLVAYIFSLFGNISIILVSHLDPQL
DSPMYFFVSNLSFLDLCYTTSTVPQMLVNLRGPEKTISYGGCVAQLYIFLALGSTECILL
AIMAFDRYAAICKPLHYPVIMNHRRCIHMAAGTWISGFANSLVQSTLTVVAPRCGQRVLD
HFFCEVPALLKLACIDIRVNEMELNVLGALLLLMPLTLILGTYVFIAQAVMRICSAESRW
KAFNTCASHLLVVSLFYFTAISMYVQPPSSYSHDRGKIMALFYGIVTPTLNPFIYTLRNK
DVKAALRRSLTKEFWIKTR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP T/A 1000GP (YRI, YRI)
6 29,258,863 29,258,863 SNP A/T rs1123283 (DbSNP)
6 29,259,154 29,259,154 SNP A/G rs71561304 (DbSNP)
6 29,291,086 29,291,086 SNP T/A 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.