Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2B7P Olfactory Receptor

Gene Symbol OR2B7P1 (View this gene in GeneCards)
Family 2
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases OR6-7, OR6-8, OR6-9, dJ313I6.3, hs6M1-31P, HsOR6.2.6P, ORL3161
External Ids HGNC: 13967   GeneBank: AB065469, AF399499, BK004559, BK004613, BK004742, NG_004280   ORDB: ORL3161   
Build #39 labels OR2B7P
Chromosomal location 6:28,046,434-28,047,368 (+)
Cluster 6@28a
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B8P 61.41% 311
OR2G3 59.02% 305
OR2W6P 59.28% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B7 85% 310
Mouse Or2b7 81% 323
Rat Or2y1c 62% 310
Cow OR2B7 89% 310
Cow OR2B7B 88% 310
Cow OR2B7C 88% 310
Orang OR2B6 63% 307
Horse OR2B7 92% 310
Chimp OR2B6 62% 307

Expression evidences

Source Accession
GNF Atlas2 gnf1h11129_at

Sequence information

Nucleotide sequence ATGGAAAGAGCTAACGACAGCACCTTCTCTGGATTCATCCTCCTGGGCTTCTCCAACAGG
CCTCAGCTGGAAACAGCTCTCTTTGTGGTCATCTTGATCATCTACTTTCTGAGCTTTCTG
GGCAATGGCACCATTATACTTTTATCCATTGTAGATCCTCGCCTCCATACCCCTATGTAT
TTCTTCCTCTCCAATCTCTCTTTTATGGATCTTTGTTTGACCACTTGTACTGTCCCTCAG
ACACTGGTCAACTTTAAGGGGAAGGACAAGACCATCACCTATGGTGGCTGCGTGACCCAG
CTATTCATTGCCTTGGGACTCGGGGGGAGTGGAGTGTGTCTTATTGTCTGCCATGGCCTA
TGACCGCTATGCAGCCGTCTGCCGCCCACTCCACTACATGGTGAGCATGCATCCCCAACT
TTGCTTGCAGTTGGTTGTAACCACTTGGCTCACAGGGTTTGGCAATTCTGTGATACAGAC
AGCATTGACCATGACTCTCCCCCTCTGTGATAAAAACCAAGTGGATCATTTCTTCTGTGA
AGTTCCAGTGATGCTGAAACTGTCCTGCACCAACACCTCCATCAACGAGGCTGAAATCTT
TGCTGTCAGTGTCTTCTTCTTGGTGGTGCCTCTCTCACTCATCTTAGCATCCTATGGTCA
CATTACTCATGCAGTCCTGAAGATAAAGTCAGCTCAAGGGAGGCAGAAGGCTTTTGGAAC
CTGTGGTTCTCACCTCCTGGTAGTGATCATTTTCTTTGGGACACTCATCTCCATGTACCT
CCAGCCTCCCTCCAGTTATTCACAGGATGTGAACAAAAGCATTGCACTCTTCTATACTCT
GGTGACTCCTCTACTGAATCCCCTAATTTACACTCTGAGGAACAAGGAAGTCAAAGGGGC
AACTAAGAAGACTAGTGGGGAGGACCATAGATGCA
Conceptual translation MERANDSTFSGFILLGFSNRPQLETALFVVILIIYFLSFLGNGTIILLSIVDPRLHTPMY
FFLSNLSFMDLCLTTCTVPQTLVNFKGKDKTITYGGCVTQLFIALGLGGS\CVLLSAMA
YDRYAAVCRPLHYMVSMHPQLCLQLVVTTWLTGFGNSVIQTALTMTLPLCDKNQVDHFFC
EVPVMLKLSCTNTSINEAEIFAVSVFFLVVPLSLILASYGHITHAVLKIKSAQGRQKAFG
TCGSHLLVVIIFFGTLISMYLQPPSSYSQDVNKSIALFYTLVTPLLNPLIYTLRNKEVKG
ATKK\VGRTIDA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP G/A 1000GP (YRI, YRI, YRI)
6 28,014,463 28,014,463 SNP C/T rs12530158 (DbSNP)
6 28,014,534 28,014,534 SNP C/G rs12530187 (DbSNP)
6 28,014,577 28,014,577 SNP A/G rs16893601 (DbSNP)
6 28,014,597 28,014,597 SNP C/T rs149900 (DbSNP)
6 28,015,112 28,015,112 Del(1) -/A rs35572414 (DbSNP)
6 28,015,113 28,015,113 Del(1) -/A rs70983928 (DbSNP)
6 28,046,685 28,046,685 SNP C/T 1000GP (CHBJPT)
6 28,046,799 28,046,799 SNP G/A 1000GP (CHBJPT)
6 28,046,819 28,046,819 SNP C/T 1000GP (CEU, CHBJPT)
6 28,046,838 28,046,838 SNP G/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
6 28,014,112 28,017,146 CopyNumber #111 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.