Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2C1 Olfactory Receptor

Gene Symbol OR2C11 (View this gene in GeneCards)
Family 2
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.34 (functional)
Aliases OR16-1, OR16-2, OLFmf3, OR2C1, HsOR16.1.3, ORL423
External Ids HGNC: 8242   GeneBank: AF098664, AF399497, BC069158, BK004407, BK004428, NM_012368   ORDB: ORL423   
Build #39 labels OR2C2P, OR2C1
Chromosomal location 16:3,355,941-3,356,876 (+)
Cluster 16@3a
Synteny CLIC#38
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2C3 58.03% 305
OR2G3 60.8% 301
OR2W6P 60.86% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2C1 87% 312
Chimp CONTIG415.105-2118 60% 308
Chimp CONTIG*********** 61% 301
Chimp CONTIG696.23-686 61% 304
Mouse Or2c1 83% 309
Rat Or2c1 85% 307
Cow OR2C1 87% 312

Expression evidences

Source Accession
ESTs EL736268
mRNA CU686823
GNF Atlas2 221460_at

Sequence information

Nucleotide sequence ATGGACGGGGTGAATGATAGCTCCTTGCAGGGCTTTGTTCTGATGGGCATATCAGACCAT
CCCCAGCTGGAGATGATCTTTTTTATAGCCATCCTCTTCTCCTATTTGCTGACCCTACTT
GGGAACTCAACCATCATCTTGCTTTCCCGCCTGGAGGCCCGGCTCCATACACCCATGTAC
TTCTTCCTCAGCAACCTCTCCTCCTTGGACCTTGCTTTCGCTACTAGTTCAGTCCCCCAA
ATGCTGATCAATTTATGGGGACCAGGCAAGACCATCAGCTATGGTGGCTGCATAACCCAG
CTCTATGTCTTCCTTTGGCTGGGGGCCACCGAGTGCATCCTGCTGGTGGTGATGGCATTT
GACCGCTACGTGGCAGTGTGCCGGCCCCTCCGCTACACCGCCATCATGAACCCCCAGCTC
TGCTGGCTGCTGGCTGTGATTGCCTGCCTGGGTGGCTTGGGCAACTCTGTGATCCAGTCA
ACATTCACTCTGCAGCTCCCATTGTGTGGGCACCGGAGGGTGGAGGGATTCCTCTGCGAG
GTGCCTGCCATGATCAAACTGGCCTGTGGCGACACAAGTCTCAACCAGGCTGTGCTCAAT
GGTGTCTGCACCTTCTTCACTGCAGTCCCACTAAGCATCATCGTGATCTCCTACTGCCTC
ATTGCTCAGGCAGTGCTGAAAATCCGCTCTGCAGAGGGGAGGCGAAAGGCGTTCAATACG
TGCCTCTCCCATCTGCTGGTGGTGTTCCTCTTCTATGGCTCAGCCAGCTATGGGTATCTG
CTTCCGGCCAAGAACAGCAAACAGGACCAGGGCAAGTTCATTTCCCTGTTCTACTCGTTG
GTCACACCCATGGTGAATCCCCTCATCTACACGCTGCGGAACATGGAAGTGAAGGGCGCA
CTGAGGAGGTTGCTGGGGAAAGGAAGAGAAGTTGGC
Conceptual translation MDGVNDSSLQGFVLMGISDHPQLEMIFFIAILFSYLLTLLGNSTIILLSRLEARLHTPMY
FFLSNLSSLDLAFATSSVPQMLINLWGPGKTISYGGCITQLYVFLWLGATECILLVVMAF
DRYVAVCRPLRYTAIMNPQLCWLLAVIACLGGLGNSVIQSTFTLQLPLCGHRRVEGFLCE
VPAMIKLACGDTSLNQAVLNGVCTFFTAVPLSIIVISYCLIAQAVLKIRSAEGRRKAFNT
CLSHLLVVFLFYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA
LRRLLGKGREVG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
16 3,406,158 3,406,158 Del(1) -/T rs5815169 (DbSNP)
16 3,406,626 3,406,626 NS A/G H/R rs11648783 (DbSNP)
16 3,405,986 3,405,986 NS A/G S/G rs1218762 (DbSNP)
16 3,406,838 3,406,838 NS A/G T/A rs62000975 (DbSNP)
16 3,406,446 3,406,446 NS A/G Y/C rs62000973 (DbSNP)
16 3,406,387 3,406,387 NS C/G C/W rs1218763 (DbSNP)
16 3,406,019 3,406,019 NS C/T L/F rs62000971 (DbSNP)
16 3,406,358 3,406,358 NS C/T L/F rs62000972 (DbSNP)
16 3,406,516 3,406,516 SYN A/G T/T rs11643487 (DbSNP)
16 3,405,994 3,405,994 SYN A/G S/S rs1228348 (DbSNP)
16 3,406,564 3,406,564 SYN A/T A/A rs62000974 (DbSNP)
16 3,356,626 3,356,626 NS G/A R/H 1000GP (CEU, CHBJPT)
16 3,355,986 3,355,986 NS G/A G/S 1000GP (CEU, CHBJPT)
16 3,355,994 3,355,994 SYN A/G S/S 1000GP (CEU, CHBJPT)
16 3,356,838 3,356,838 NS G/A A/T 1000GP (CEU)
16 3,356,516 3,356,516 SYN A/G T/T 1000GP (CEU, CHBJPT)
16 3,356,387 3,356,387 NS C/G C/W 1000GP (CEU)
16 3,356,112 3,356,112 NS C/T P/S 1000GP (CHBJPT)
16 100 -100 NS G/A G/S 1000GP (YRI, YRI, YRI, YRI, YRI)
16 100 -100 SYN A/G S/S 1000GP (YRI, YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G16S P58S C169Y R172W E180K R229H P262L A300T G312D % Freq CORP
1 G P C R E R P A G 70.28 0.563
2 S P C R E H P A G 24.19 0.563
3 G S C R E R P A G 2.07 0.733
4 S P Y R E H P A G 1.31 0.563
5 G P C R E R P A D 0.84 0.563
6 G P C R E R P T G 0.69 0.563
7 G P C W E R P A G 0.15 0.563
8 G P C R E R L A G 0.15 0.563
9 G P C R E H P A G 0.15 0.563
10 S P C R K H P A G 0.08 0.563
11 G P C R K R P A G 0.08 0.563

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2C1.aApr07-unspliced main_exon 5UTR chr16 3,355,889 3,355,941 +
CDS chr16 3,355,941 3,356,876 +
3UTR chr16 3,356,876 3,356,924 +