Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2H2 Olfactory Receptor

Gene Symbol OR2H21 (View this gene in GeneCards)
Family 2
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.17 (functional)
Aliases hs6M1-12, OR6-36, AC006137-A, dJ271M21.2, HsOR6.3.26, ORL4124
External Ids HGNC: 8253   GeneBank: AB065965, AF211939-AF211942, AF399631, BC069146, BK004225, NM_007160   ORDB: ORL4124   
Build #39 labels OR2H2
Chromosomal location 6:29,587,945-29,588,880 (+)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2H1 86.86% 312
OR2H5P 88.78% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2H17P 71% 308
Chimp CONTIG696.23-686 97% 312
Mouse Or2h2 88% 307
Rat Or2h2 88% 307
Rat Or2h2c 85% 312
Rat Or2h1 83% 306
Rat Or2h1b-ps 82% 313
Cow OR2H1D 84% 312
Cow OR2H1 83% 306

Expression evidences

Source Accession
ESTs DB306652
mRNA BC069146
GNF Atlas2 208573_s_at
GNF Atlas2 217081_at

Sequence information

Nucleotide sequence ATGGTTAACCAAAGCTCCACACCGGGCTTCCTCCTTCTGGGCTTCTCTGAACACCCAGGG
CTGGAAAGGACTCTCTTCGTGGTTGTCTTCACTTCCTACCTCCTAACCCTAGTGGGCAAC
ACACTCATCATCCTGCTGTCTGCGCTGGACCCCAAGCTCCACTCTCCAATGTACTTTTTC
CTCTCCAACCTCTCCTTCTTGGACCTCTGTTTCACCACGAGTTGTGTTCCCCAAATGCTG
GTCAACCTCTGGGGCCCAAAGAAGACCATCAGCTTCCTGGACTGCTCTGTCCAGATCTTC
ATCTTCCTGTCCCTGGGGACAACTGAGTGCATCCTCTTGACAGTGATGGCTTTTGATCGC
TACGTGGCTGTCTGCCAGCCCCTCCACTATGCCACCATCATCCACCCCCGCCTGTGCTGG
CAGCTGGCATCTGTGGCCTGGGTCATTGGGCTAGTGGAGTCAGTGGTCCAGACACCATCC
ACCCTGCACCTGCCCTTCTGCCCCGATCGGCAGGTGGATGATTTTGTCTGTGAGGTCCCA
GCTCTAATTCGACTCTCCTGTGAAGACACCTCCTACAATGAGATCCAGGTGGCTGTTGCC
AGTGTCTTCATCTTGGTTGTGCCTCTCAGCCTCATCCTTGTCTCTTACGGAGCCATTACC
TGGGCAGTGCTGAGGATTAACTCTGCAAAAGGGCGGAGGAAAGCTTTTGGGACCTGCTCC
TCCCATCTCACTGTGGTCACCCTCTTCTACAGCTCAGTCATTGCTGTCTACCTCCAGCCC
AAAAATCCCTATGCCCAAGAGAGGGGCAAGTTCTTTGGTCTCTTCTATGCAGTGGGCACT
CCTTCACTTAACCCTCTCATATACACCCTGAGGAACAAGGAGGTAACCAGGGCATTCAGG
AGATTGCTGGGGAAGGAAATGGGGCTCACACAAAGC
Conceptual translation MVNQSSTPGFLLLGFSEHPGLERTLFVVVFTSYLLTLVGNTLIILLSALDPKLHSPMYFF
LSNLSFLDLCFTTSCVPQMLVNLWGPKKTISFLDCSVQIFIFLSLGTTECILLTVMAFDR
YVAVCQPLHYATIIHPRLCWQLASVAWVIGLVESVVQTPSTLHLPFCPDRQVDDFVCEVP
ALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVSYGAITWAVLRINSAKGRRKAFGTCS
SHLTVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFR
RLLGKEMGLTQS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 NS C/T L/F 1000GP (YRI, YRI)
6 100 -100 SYN A/G P/P 1000GP (YRI)
6 29,555,738 29,555,738 NS A/C Y/S rs61744969 (DbSNP)
6 29,555,778 29,555,778 SYN G/A P/P rs2235698 (DbSNP)
6 29,555,809 29,555,809 NS A/C/G/T L/F/V/I rs3129034 (DbSNP)
6 29,555,833 29,555,833 NS A/G M/V rs11966382 (DbSNP)
6 29,555,864 29,555,864 NS T/C V/A rs1233387 (DbSNP)
6 29,556,100 29,556,100 NS C/T P/S rs36211077 (DbSNP)
6 29,556,225 29,556,225 SYN C/T P/P rs61997184 (DbSNP)
6 29,556,345 29,556,345 SYN C/T P/P rs72500875 (DbSNP)
6 29,556,416 29,556,416 NS A/G Q/R rs73744761 (DbSNP)
6 29,587,961 29,587,961 NS C/A S/Y 1000GP (CHBJPT)
6 29,588,001 29,588,001 SYN A/G P/P 1000GP (CEU, CHBJPT)
6 29,588,032 29,588,032 NS C/T L/F 1000GP (CEU, CHBJPT)
6 29,588,087 29,588,087 NS C/T A/V 1000GP (CEU, CHBJPT)
6 29,588,448 29,588,448 SYN C/T P/P 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
6 29,469,101 29,678,670 CopyNumber Variation_3598 (DGV)
6 29,527,407 29,566,446 CopyNumber Variation_36504 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S6Y L30F A48V E838D % Freq CORP
1 S F A E 46.31 0.340
2 S F V E 28.42 0.340
3 S L A E 22.35 0.340
4 Y F V E 2.84 0.340
5 S F A D 0.08 0.340

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2H2.aApr07 exon_5UTR chr6 29,586,041 29,586,154 +
main_exon 5UTR chr6 29,587,670 29,587,945 +
CDS chr6 29,587,945 29,588,880 +
3UTR chr6 29,588,880 29,588,968 +
OR2H2.bApr07-unspliced main_exon 5UTR chr6 29,587,455 29,587,945 +
CDS_partial chr6 29,587,945 29,588,153 +