Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2H4P Olfactory Receptor

Gene Symbol OR2H4P1 (View this gene in GeneCards)
Family 2
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR6-21, dJ80I19.6, OR6-3, hs6M1-7, HsOR6.3.10P, ORL3168
External Ids HGNC: 8255   GeneBank: AB065473, BK004723, HSA302634-HSA302643, NG_004685   ORDB: ORL3168   
Build #39 labels OR2H4P
Chromosomal location 6:29,215,236-29,216,176 (+)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2H1 58.01% 312
OR2H2 62.25% 302
OR2W6P 59.86% 294

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2W6 59% 301
Mouse Or2h15 78% 313
Rat Or2h15 76% 313
Cow OR2H4B 81% 314
Orang OR2H4 94% 314
Horse OR2H4 85% 314
Chimp OR2H5P 59% 302

Sequence information

Nucleotide sequence ATGATTATAATTTGCAATGACAGCCACAGTGATTTCATCCTTCTGGGCTTCTCTAACAAG
CCACATTTGGAGAAGATACTTTTTGGATCATTTTTATTTTTTATTTTTTGACTCTTGCAG
GAAATATGGTCATAGTTCTTGTGTCCTTGAAGGATCCAAAACTCCACATCCCTATGTATT
TCTTTCTTTCCAACCTTTCCTTGGTAGACCTCTGTTTGACCAGCAGCTGTGTTCCACAGA
TGTTGATTAACTTCTGGGGCCCAGAAAAGACCATCAGCTACATTGGCTGTGCCATTCAAC
TCTATGTTTTTTTGTGGCTTGGGGCCACGGAATATGTCCTTCTTGTTGTCATGGCTGTGG
ATTGTTATGTAGCAGTGTGTCATCCACTGCAAAATACCATGATCATGCACCCAAAACTTT
GTCTGCAGCTGGCTATCTTGGCATGGGGGACTGGCTTGGCCCAGTCTCTGATCCAGTCCC
CTGCCACCCTCCGGTTACCCTTCTGCTCCCAGCGGATGGTGGATGATGTTGTTTGTGAAG
TCCCAGCTCTGATTCAGCTCTCCAGTACTGATACTACCTACAGTGAAATTCAGATGTCTA
TCGCCAGTGTTGTCCTCCTGGTGATGCCCTTGATCATTATCCTTTCCTCTTCTGGTGCTA
TTGCTAAGGCTGTGCTGAGAATTAAGTCAACTGCAGGACAGAAGAAAGCATTTGGCACCT
GCATCTCTCACCTTCTTGTGGTTTCTCTCTTTTATGGCACTGTCACAGGTGTCTACCTTC
AACCAAAAAATCACTATCCTCATGAATGGGGCAAATTTCTCACTCTTTTCTACACTGTAG
TAACCCCAACTCTTAATCCCCTCATCTACACTCTAAGGAACAAGGAGGTAAAGGGAGCAC
TAATAAGATTGGGGAGGAGGACCTGGGATTCCCAGAATAAC
Conceptual translation MIIICNDSHSDFILLGFSNKPHLEKILF/IIFIFYFLTLAGNMVIVLVSLKDPKLHIPM
YFFLSNLSLVDLCLTSSCVPQMLINFWGPEKTISYIGCAIQLYVFLWLGATEYVLLVVMA
VDCYVAVCHPLQNTMIMHPKLCLQLAILAWGTGLAQSLIQSPATLRLPFCSQRMVDDVVC
EVPALIQLSSTDTTYSEIQMSIASVVLLVMPLIIILSSSGAIAKAVLRIKSTAGQKKAFG
TCISHLLVVSLFYGTVTGVYLQPKNHYPHEWGKFLTLFYTVVTPTLNPLIYTLRNKEVKG
ALIRLGRRTWDSQNN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP G/A 1000GP (YRI, YRI)
6 29,183,346 29,183,346 SNP A/G rs3129096 (DbSNP)
6 29,183,869 29,183,869 SNP A/T rs11758554 (DbSNP)
6 29,215,569 29,215,569 SNP G/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 3 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.