Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2J2 Olfactory Receptor

Gene Symbol OR2J21 (View this gene in GeneCards)
Family 2
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.81 (pseudogene)
Aliases OR6-19, OR6-8, hs6M1-6, dJ80I19.4, HsOR6.3.8, ORL682, ORL1032, ORL683, ORL684
External Ids HGNC: 8260   GeneBank: BC069121, BK004438, HSA302571-HSA302582, NM_030905   ORDB: ORL682, ORL1032, ORL683, ORL684   
Build #39 labels OR2J2
Chromosomal location 6:29,173,636-29,174,571 (+)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2J1P 91.59% 309
OR2J3 88.56% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B2 61% 305
Chimp CONTIG*********** 92% 309
Mouse Or2j3 81% 307
Rat Or2j3 81% 301
Cow OR2J3 87% 304
Cow OR2J3C 86% 307
Cow OR2J1 88% 307
Cow OR2J3B 86% 307
Cow OR2J3D 87% 304

Expression evidences

Source Accession
ESTs BU182611
mRNA BC108899
GNF Atlas2 208508_s_at

Sequence information

Nucleotide sequence ATGATGATTAAAAAAAATGCAAGTTCGGAAGACTTCTTTATTCTACTTGGATTTTCTAAT
TGGCCTCAGCTGGAAGTAGTTCTCTTTGTGGTTATCTTGATCTTCTACCTGATGACACTG
ACAGGAAACCTGTTCATCATCATCCTGTCATACGTGGACTCCCATCTCCACACACCAATG
TACTTCTTCCTTTCAAACCTCTCATTTCTGGATCTCTGCCACACCACCAGCTCTATCCCT
CAGTTGCTGGTGAATCTCCGGGGCCCGGAAAAGACCATCTCGTATGCTGGTTGCATGGTT
CAACTTTACTTTGTTCTTGCACTGGGAATCGCAGAGTGTGTCCTACTGGTGGTGATGTCG
TATGATCGTTATGTAGCTGTGTGTAGACCTTTGCATTACACTGTCCTCATGCACCCTCGT
TTCTGCCACTTGTTGGCTGCGGCTTCTTGGGTAATTGGTTTTACTATCTCAGCACTTCAT
TCCTCCTTTACTTTCTGGGTACCCCTTTGTGGACATCGCCTAGTGGATCACTTCTTCTGT
GAAGTTCCAGCACTTCTGCGTTTATCATGTGTTGACACCCATGCAAATGAGCTGACCCTC
ATGGTCATGAGCTCCATTTTTGTTCTCATACCTCTCATTCTGATTCTCACTGCCTATGGT
GCCATTGCCCGGGCTGTACTGAGCATGCAATCAACCACTGGGCTTCAGAAAGTGTTTAGG
ACATGTGGAGCCCATCTTATGGTTGTATCTCTCTTTTTCATTCCAGTCATGTGCATGTAT
CTCCAGCCACCATCAGAAAATTCTCCTGATCAGGGCAAGTTCATTGCCCTCTTTTATACT
GTTGTCACACCGAGTCTTAATCCTCTAATCTACACTCTCAGAAACAAGCATGTAAAAGGG
GCAGCGAAGAGACTATTGGGGTGGGAGTGGGGGAAG
Conceptual translation MMIKKNASSEDFFILLGFSNWPQLEVVLFVVILIFYLMTLTGNLFIIILSYVDSHLHTPM
YFFLSNLSFLDLCHTTSSIPQLLVNLRGPEKTISYAGCMVQLYFVLALGIAECVLLVVMS
YDRYVAVCRPLHYTVLMHPRFCHLLAAASWVIGFTISALHSSFTFWVPLCGHRLVDHFFC
EVPALLRLSCVDTHANELTLMVMSSIFVLIPLILILTAYGAIARAVLSMQSTTGLQKVFR
TCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYTVVTPSLNPLIYTLRNKHVKG
AAKRLLGWEWGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 NS C/A A/E 1000GP (YRI, YRI, YRI)
6 100 -100 SYN A/G S/S 1000GP (YRI, YRI)
6 29,141,449 29,141,448 Ins(1) -/T rs72202226 (DbSNP)
6 29,141,632 29,141,632 NS C/T H/Y rs3116855 (DbSNP)
6 29,141,743 29,141,743 NS A/G T/A rs3129157 (DbSNP)
6 29,141,772 29,141,772 SYN A/C/G S/S rs3129158 (DbSNP)
6 29,141,849 29,141,849 NS C/T A/V rs3116856 (DbSNP)
6 29,142,020 29,142,020 NS C/T T/M rs62405964 (DbSNP)
6 29,142,030 29,142,030 SYN A/T I/I rs61733733 (DbSNP)
6 29,142,054 29,142,054 SYN C/G L/L rs3129159 (DbSNP)
6 29,142,064 29,142,064 NS A/G T/A rs3130743 (DbSNP)
6 29,142,317 29,142,317 NS C/T A/V rs41270628 (DbSNP)
6 29,142,347 29,142,347 NS A/T K/M rs41270632 (DbSNP)
6 29,173,966 29,173,966 NS A/G T/A 1000GP (CEU, CHBJPT)
6 29,173,995 29,173,995 SYN A/G S/S 1000GP (CEU, CHBJPT)
6 29,174,072 29,174,072 NS T/C V/A 1000GP (CEU, CHBJPT)
6 29,174,277 29,174,277 SYN C/G L/L 1000GP (CEU, CHBJPT)
6 29,174,287 29,174,287 NS A/G T/A 1000GP (CEU, CHBJPT)
6 29,174,540 29,174,540 NS C/T A/V 1000GP (CEU)
6 29,174,570 29,174,570 NS A/T K/M 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
6 29,091,539 29,163,849 CopyNumber Variation_64459 (DGV)
6 29,099,579 29,149,561 CopyNumber Variation_51868 (DGV)
6 29,141,313 29,144,348 Deletion #191 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V52M Y74H R87Q A107E E112K V146A A195G M203T T218A A302V K312M % Freq CORP
1 V Y R A E V A M T A K 56.07 0.789
2 V H R A E A A M A A K 33.87 0.789
3 V Y R A E A A M T A K 3.76 0.789
4 V Y R A E V A M T A M 3.23 0.789
5 V Y R E E V A M T A K 0.84 0.789
6 V H R A E A A M T A K 0.38 0.789
7 V Y R A E V A M T V K 0.38 0.789
8 V H R A E V A M A A K 0.38 0.789
9 V H R A E V A M T A K 0.31 0.789
10 V Y R A E V A T T A K 0.23 0.789
11 V Y R A K V A M T A K 0.15 0.822
12 V Y Q A E V A M T A K 0.08 0.789
13 V Y R A E V A M A V K 0.08 0.789
14 V H R A E A G M A A K 0.08 0.789
15 V Y R A E A A M A A K 0.08 0.789
16 M Y R A E V A M T A M 0.08 0.789

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2J2.aApr07-unspliced main_exon 5UTR chr6 29,173,303 29,173,636 +
CDS chr6 29,173,636 29,174,571 +
3UTR chr6 29,174,571 29,174,574 +