Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2J3 Olfactory Receptor

Gene Symbol OR2J31 (View this gene in GeneCards)
Family 2
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.62 (pseudogene)
Aliases OR6-6, hs6M1-3, dJ80I19.7, OR6-16, HsOR6.3.6, ORL692, ORL671
External Ids HGNC: 8261   GeneBank: AF399630, BK004437, HSA302547-HSA302558, NM_001005216   ORDB: ORL692, ORL671   
Build #39 labels OR2J3
Chromosomal location 6:29,111,891-29,112,823 (+)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2J1P 89.54% 306
OR2J2 88.56% 306
OR2J4P 89.71% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B2 62% 304
Chimp CONTIG*********** 90% 311
Chimp CONTIG*********** 90% 306
Chimp CONTIG*********** 99% 272
Mouse Or2j3 83% 304
Rat Or2j3 84% 297
Cow OR2J3 92% 309
Cow OR2J3C 91% 304
Cow OR2J3B 89% 304
Cow OR2J3D 91% 304
Cow OR2J1 91% 305

Expression evidences

Source Accession
mRNA BC136975
GNF Atlas2 217334_at

Sequence information

Nucleotide sequence ATGAATGATGATGGAAAAGTCAATGCTAGCTCTGAGGGGTACTTTATTTTAGTTGGATTT
TCTAATTGGCCTCATCTGGAAGTAGTTATCTTTGTGGTTGTCTTGATCTTCTACTTGATG
ACACTGATAGGAAACCTGTTCATCATCATCCTGTCATACCTGGACTCCCATCTGCACACA
CCAATGTACTTCTTCCTTTCAAACCTCTCATTTCTGGATCTCTGCTACACCACCAGCTCT
ATCCCTCAGTTGCTGGTCAATCTCTGGGGCCCGGAAAAGACCATCTCTTATGCTGGTTGC
ATGATTCAACTTTACTTTGTTCTCGCACTGGGAACCACAGAGTGTGTCCTACTGGTGGTG
ATGTCCTATGACCGTTATGCAGCTGTGTGTAGACCTTTGCATTACACTGTCCTCATGCAC
CCTCGTTTCTGCCACCTGCTGGCTGTGGCTTCTTGGGTAAGTGGTTTTACCAACTCAGCA
CTTCATTCCTCCTTCACCTTCTGGGTACCTCTGTGTGGACACCGCCAAGTAGATCACTTT
TTCTGTGAAGTTCCAGCACTTCTGCGATTATCGTGTGTTGATACCCATGTCAATGAGCTG
ACCCTCATGATCACAAGCTCCATATTTGTTCTCATACCTCTCATCCTCATTCTCACTTCT
TATGGTGCCATCGTCCGAGCTGTACTGAGGATGCAGTCAACCACTGGGCTTCAGAAAGTG
TTTGGAACATGTGGAGCTCATCTTATGGCTGTATCTCTCTTTTTCATTCCGGCCATGTGC
ATATATCTCCAGCCACCATCAGGAAATTCTCAAGATCAAGGCAAGTTCATTGCCCTCTTT
TATACTGTTGTCACACCTAGTCTTAACCCTCTAATCTACACCCTCAGAAACAAAGTTGTA
AGAGGGGCAGTGAAGAGACTAATGGGGTGGGAA
Conceptual translation MNDDGKVNASSEGYFILVGFSNWPHLEVVIFVVVLIFYLMTLIGNLFIIILSYLDSHLHT
PMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTTECVLLVV
MSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHF
FCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVRAVLRMQSTTGLQKV
FGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVV
RGAVKRLMGWE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 NS A/G T/A 1000GP (YRI, YRI, YRI, YRI)
6 29,080,004 29,080,004 NS A/G T/A rs28757581 (DbSNP)
6 29,080,344 29,080,344 NS G/A R/Q rs3749977 (DbSNP)
6 29,080,349 29,080,349 NS A/G I/V rs3130764 (DbSNP)
6 29,080,450 29,080,450 NS A/G I/M rs3130765 (DbSNP)
6 29,112,227 29,112,227 NS A/G T/A 1000GP (CEU, CHBJPT)
6 29,112,567 29,112,567 NS G/A R/Q 1000GP (CEU, CHBJPT)
6 29,112,572 29,112,572 NS A/G I/V 1000GP (CEU, CHBJPT)
6 29,112,609 29,112,609 NS T/C V/A 1000GP (CEU)
6 29,112,673 29,112,673 NS G/A M/I 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A109T T113A V240A M261I % Freq CORP
1 A T V I 50.46 0.591
2 A T V M 27.57 0.591
3 A A V I 17.28 0.591
4 A A A I 2.30 0.336
5 T T V I 1.92 0.591
6 A T A I 0.46 0.336

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2J3.aApr07-unspliced main_exon 5UTR chr6 29,111,560 29,111,891 +
CDS chr6 29,111,891 29,112,823 +
3UTR chr6 29,112,823 29,112,826 +