Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2M2 Olfactory Receptor

Gene Symbol OR2M21 (View this gene in GeneCards)
Family 2
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OST423, HsOR1.5.30, ORL3817
External Ids HGNC: 8268   GeneBank: AF399616, NM_001004688   ORDB: ORL3817   
Build #39 labels OR2M2
Chromosomal location 1:248,179,986-248,181,026 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2M3 92.26% 310
OR2M5 91.26% 309
OR2M7 92.26% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2M10P 79% 312
Chimp CONTIG1126.15-525 97% 347
Mouse Or2m12 74% 310
Rat Or2m12 75% 307
Cow OR2M10 77% 310

Sequence information

Nucleotide sequence ATGGCATGGGAGAATCAGACCTTCAACTCCGACTTCATCCTCCTTGGAATCTTCAATCAC
AGCCCACCACACACGTTCCTCTTCTTTCTGGTCCTGGGCATCTTTTTAGTGGCCTTCATG
GGAAACTCTGTCATGGTTCTCCTCATCTACCTGGACACCCAGCTCCACACCCCCATGTAC
TTCCTCCTCAGCCAACTGTCCCTCATGGACCTCATGCTCATCTGCACCACCGTACCCAAG
ATGGCCTTCAACTACCTGTCTGGCAGCAAGTCCATTTCTATGGCTGGTTGTGTCACACAA
ATTTTCTTCTATATATCACTGTCTGGCTCTGAATGTTTTCTTTTGGCTGTTATGGCTTAT
GACCGCTATATTGCTATTTGCCACCCTCTAAGATATACCAATCTCATGAATCCTAAAATT
TGTGGACTTATGGCTACCTTCTCCTGGATCCTGGGCTCTACAGATGGAATCATTGATGCT
GTAGCCACATTTTCCTTCTCCTTTTGTGGGTCTCGGGAAATAGCCCACTTCTTCTGTGAA
TTCCCTTCCCTACTAATCCTCTCATGCAATGACACATCAATATTTGAAGAGGTTATTTTC
ATCTGCTGTATAGTAATGCTTGTTTTCCCTGTTGCAATCATCATTGCTTCCTATGCTCGA
GTTATTCTGGCTGTCATTCACATGGGATCTGGAGAGGGTCGTTGCAAAGCTTTCACGACC
TGTTCCTCTCACCTCATGGTGGTGGGAATGTACTATGGAGCAGCTTTGTTCATGTACATA
CGGCCCACATCTGATCACTCCCCAACGCAGGACAAGATGGTGTCTGTATTCTACACCATC
CTCACTCCCATGCTGAATCCCCTCATCTACAGCCTCCGCAACAAGGAGGTGACTAGAGCA
TTCATGAAGATCTTAGGAAAGGGCAAGTCTGAGAGTGAGTTACCTCATAAACTTTATGTT
TTGCTGTTTGCTAAATTCTTCTTTCTAATATCCATCTTTTTCTATGATGTCAAAATACTA
GCATTGATTATGTACATTGCC
Conceptual translation MAWENQTFNSDFILLGIFNHSPPHTFLFFLVLGIFLVAFMGNSVMVLLIYLDTQLHTPMY
FLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCVTQIFFYISLSGSECFLLAVMAY
DRYIAICHPLRYTNLMNPKICGLMATFSWILGSTDGIIDAVATFSFSFCGSREIAHFFCE
FPSLLILSCNDTSIFEEVIFICCIVMLVFPVAIIIASYARVILAVIHMGSGEGRCKAFTT
CSSHLMVVGMYYGAALFMYIRPTSDHSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVTRA
FMKILGKGKSESELPHKLYVLLFAKFFFLISIFFYDVKILALIMYIA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 248,340,182 248,340,182 large insertion 22252bp insertion rs72482064 (DbSNP)
1 248,343,350 248,343,349 Ins(1) -/C rs34678055 (DbSNP)
1 248,343,543 248,343,543 SYN C/T L/L rs9435919 (DbSNP)
1 248,343,547 248,343,547 NS C/G S/C rs61156873 (DbSNP)
1 248,343,945 248,343,945 NS C/G R/G rs4244171 (DbSNP)
1 248,343,990 248,343,990 NS C/T R/C rs4916104 (DbSNP)
1 248,343,996 248,343,996 NS A/G T/A rs9435890 (DbSNP)
1 248,344,156 248,344,156 NS A/G Y/C rs41311591 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,319,780 248,490,372 CopyNumber Variation_31702 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R220G C235R C235Y A237T R293C % Freq CORP
1 G R C A R 49.77 0.103
2 R C C A R 45.78 0.103
3 G C C A R 2.23 0.103
4 R R C A R 1.38 0.103
5 G R Y A R 0.54 0.103
6 G R C T R 0.23 0.248
7 G R C A C 0.08 0.103

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2M2.aApr07-unspliced main_exon CDS chr1 248,179,986 248,181,026 +
3UTR chr1 248,181,026 248,181,029 +