Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2M3 Olfactory Receptor

Gene Symbol OR2M31 (View this gene in GeneCards)
Family 2
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR1-54, OST003, HsOR1.5.31
External Ids HGNC: 8269   GeneBank: AB065952, AF399483, BK004482, NM_001004689   
Build #39 labels OR2M6, OR2M3P
Chromosomal location 1:248,203,068-248,204,003 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2M2 92.26% 310
OR2M5 92.95% 312
OR2M7 91.67% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2M10P 80% 309
Chimp CONTIG1126.19-1573 97% 302
Chimp CONTIG25656.1-1150 93% 310
Chimp CONTIG1126.11-12304 92% 312
Mouse Or2m12 75% 308
Rat Or2m12 76% 306
Cow OR2M10 78% 312

Expression evidences

Source Accession
mRNA BC136971
GNF Atlas2 gnf1h02158_s_at
GNF Atlas2 gnf1h02159_x_at

Sequence information

Nucleotide sequence ATGGCAAGGGAGAATTCGACCTTCAACTCCGACTTCATCCTCCTGGGAATCTTCAATCAC
AGCCCCACCCACACCTTCCTCTTCTTTCTGGTCCTGGCCATCTTTTCAGTGGCCTTCATG
GGAAACTCTGTCATGGTTCTCCTCATCTACCTGGACACCCAGCTCCACACCCCCATGTAC
CTCCTCCTCAGCCAACTGTCCCTCATGGACCTCATGCTCATCTGCACCACCGTACCCAAG
ATGGCCTTCAACTACCTGTCTGGCAGCAAGTCCATTTCTATGGCTGGTTGTGCCACACAA
ATTTTCTTCTATACATCACTGCTTGGCTCTGAGTGCTTTCTTTTGGCTGTTATGGCTTAT
GACCGCTACACTGCCATTTGCCACCCTCTAAGATACACCAATCTCATGAGCCCTAAAATT
TGTGGACTTATGACTGCCTTTTCCTGGATCCTGGGCTCTACGGATGGAATTATTGATGTT
GTAGCAACATTTTCCTTCTCCTACTGTGGGTCTCGGGAAATAGCCCACTTCTTCTGTGAC
TTCCCCTCCCTACTAATCCTCTCATGCAGTGACACATCAATATTTGAAAAGATTCTTTTC
ATCTGCTGTATAGTAATGATTGTTTTCCCTGTTGCAATCATCATTGCTTCCTATGCTCGA
GTTATCCTGGCTGTCATTCACATGGGATCTGGAGAGGGTCGTCGCAAAGCTTTTACTACT
TGTTCCTCTCACCTCTTGGTGGTGGGAATGTACTATGGAGCAGCTTTGTTCATGTACATA
CGGCCCACATCTGATCGCTCCCCAACACAGGACAAGATGGTGTCTGTATTCTACACCATC
CTCACTCCCATGTTGAATCCCCTCATCTACAGCCTCCGCAACAAGGAGGTGACCAGAGCA
TTCATGAAGATCTTAGGAAAGGGCAAGTCTGGAGAG
Conceptual translation MARENSTFNSDFILLGIFNHSPTHTFLFFLVLAIFSVAFMGNSVMVLLIYLDTQLHTPMY
LLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYTSLLGSECFLLAVMAY
DRYTAICHPLRYTNLMSPKICGLMTAFSWILGSTDGIIDVVATFSFSYCGSREIAHFFCD
FPSLLILSCSDTSIFEKILFICCIVMIVFPVAIIIASYARVILAVIHMGSGEGRRKAFTT
CSSHLLVVGMYYGAALFMYIRPTSDRSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVTRA
FMKILGKGKSGE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/A D/N 1000GP (YRI, YRI, YRI)
1 100 -100 SYN G/A E/E 1000GP (YRI, YRI, YRI)
1 248,203,400 248,203,400 SYN G/A E/E 1000GP (CEU, CHBJPT)
1 248,203,490 248,203,490 SYN T/C C/C 1000GP (CEU, CHBJPT)
1 248,366,493 248,366,493 NS A/T N/Y rs12562699 (DbSNP)
1 248,366,702 248,366,702 SYN A/G E/E rs4916112 (DbSNP)
1 248,366,765 248,366,765 SYN C/T Y/Y rs61736249 (DbSNP)
1 248,366,792 248,366,792 SYN C/T C/C rs12562957 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,319,780 248,490,372 CopyNumber Variation_31702 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D11N A216T Y259H I289N R293S M302T % Freq CORP
1 D A Y I R M 97.93 0.103
2 D A Y N R M 0.77 0.103
3 D T Y I R M 0.38 0.103
4 D A H I R M 0.31 0.103
5 N A Y I R M 0.23 0.103
6 D A Y I S M 0.23 0.103
7 D A Y I R T 0.15 0.103

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2M3.aApr07-unspliced main_exon CDS chr1 248,203,068 248,204,003 +
3UTR chr1 248,204,003 248,204,006 +