Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2M5 Olfactory Receptor

Gene Symbol OR2M51 (View this gene in GeneCards)
Family 2
Subfamily M
Pseudogene No
CORP pseudogene probability score 0 (functional)
Aliases HsOR1.5.29
External Ids HGNC: 19576   GeneBank: NM_001004690   
Build #39 labels OR2M5P
Chromosomal location 1:248,145,148-248,146,083 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2M2 91.26% 309
OR2M3 92.95% 312
OR2M7 92.63% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2M10P 77% 310
Chimp CONTIG1126.11-12304 96% 312
Chimp CONTIG25656.1-1150 94% 309
Chimp CONTIG1126.15-525 91% 309
Mouse Or2m12 72% 309
Rat Or2m12 74% 307
Cow OR2M10 75% 312

Sequence information

Nucleotide sequence ATGGCATGGGAGAATCAGACCTTCAACTCTGACTTCATCCTCCTGGGAATCTTCAATCAC
AGCCCCACCCACACCTTCCTCTTCTTTCTGGTCCTGGCCATCTTTTCAGTGGCCTTCATG
GGAAACTCTGTCATGGTTCTCCTCATCTACCTGGACACCCAGCTCCACACCCCCATGTAC
TTCCTCCTCAGTCAACTGTTCCTCATGGACCTCATGCTCATCTGCTCTACCGTACCCAAG
ATGGCCTTCAACTACTTGTCTGGCAGCAAGTCCATTTCTATGGCTGGTTGTGCCACACAA
ATTTTCTTCTATGTATCACTGCTTGGCTCCGAATGCTTTCTGTTGGCTGTTATGTCTTAT
GACCGCTATATTGCCATTTGCCACCCTCTAAGATACACCAATCTCATGAGACCCAAAATT
TGTGGACTTATGACTGCCTTCTCCTGGATCCTGGGCTCTATGGATGCAATCATTGATGCT
GTAGCGACATTTTCCTTCTCCTACTGTGGGTCTCGGGAAATAGCCCACTTCTTCTGTGAC
TTCCCTTCCCTACTAATCCTCTCATGCAATGACACATCAATATTTGAAAAGGTTCTTTTC
ATCTGCTGTATAGTAATGATTGTTTTTCCTGTTGCAATCATCATCGCTTCCTATGCTCGA
GTTATTCTGGCTGTCATTCACATGGGATCTGGAGAGGGTCGTCGCAAAGCTTTTACTACC
TGTTCCTCTCACCTCATGGTGGTGGGAATGTACTATGGAGCAGGTTTGTTCATGTACATA
CGGCCCACATCTGATCGCTCCCCTATGCAGGACAAGCTGGTGTCTGTATTCTACACCATC
CTCACTCCCATGCTGAATCCCCTCATCTACAGCCTCCGCAACAAGGAGGTGACCAGAGCA
CTCAGGAAAGTGTTAGGAAAGGGCAAGTGTGGAGAG
Conceptual translation MAWENQTFNSDFILLGIFNHSPTHTFLFFLVLAIFSVAFMGNSVMVLLIYLDTQLHTPMY
FLLSQLFLMDLMLICSTVPKMAFNYLSGSKSISMAGCATQIFFYVSLLGSECFLLAVMSY
DRYIAICHPLRYTNLMRPKICGLMTAFSWILGSMDAIIDAVATFSFSYCGSREIAHFFCD
FPSLLILSCNDTSIFEKVLFICCIVMIVFPVAIIIASYARVILAVIHMGSGEGRRKAFTT
CSSHLMVVGMYYGAGLFMYIRPTSDRSPMQDKLVSVFYTILTPMLNPLIYSLRNKEVTRA
LRKVLGKGKCGE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS A/G K/E 1000GP (YRI)
1 100 -100 SYN A/T S/S 1000GP (YRI, YRI)
1 248,145,614 248,145,614 NS C/G A/G 1000GP (CEU)
1 248,146,054 248,146,054 NS A/G K/E 1000GP (CEU, CHBJPT)
1 248,308,436 248,308,436 large insertion 57477bp insertion rs72482063 (DbSNP)
1 248,308,933 248,308,933 NS A/G T/A rs59407768 (DbSNP)
1 248,309,107 248,309,107 NS C/G R/G rs41305578 (DbSNP)
1 248,309,159 248,309,159 NS A/C D/A rs41304157 (DbSNP)
1 248,309,356 248,309,356 NS A/G K/E rs73141283 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,308,350 248,311,385 CopyNumber #30 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G16R M144T A162V A216T R220P M228V R235H A237D L292V K303E L305* % Freq CORP
1 G M A A R M R A L K L 87.79 0.009
2 G M A A R M R A L E L 6.61 0.009
3 G M V A R M R D L K L 1.46 0.024
4 G M A A R M R A V K L 1.23 0.009
5 G T A A R M R A L K L 0.69 0.009
6 G M A A R M R D L K L 0.69 0.024
7 R M A A R M R A L K L 0.54 0.009
8 G M A A P M H A L K L 0.38 0.009
9 G M A A R M R A L K * 0.23 1.200
10 G M A A R V R A L K L 0.15 0.009
11 G M A T R M R A L K L 0.15 0.009
12 G M V A R M H D L K L 0.08 0.024

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2M5.aApr07-unspliced main_exon CDS chr1 248,145,148 248,146,083 +
3UTR chr1 248,146,083 248,146,086 +