Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2M7 Olfactory Receptor

Gene Symbol OR2M71 (View this gene in GeneCards)
Family 2
Subfamily M
Pseudogene No
CORP pseudogene probability score
Aliases OR1-58, HsOR1.5.35
External Ids HGNC: 19594   GeneBank: AB065954, BK004486, NM_001004691   
Build #39 labels OR2M7
Chromosomal location 1:248,323,633-248,324,568 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2M2 92.26% 310
OR2M3 91.67% 312
OR2M5 92.63% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2M10P 76% 310
Chimp CONTIG25656.1-1150 99% 310
Mouse Or2m12 72% 309
Rat Or2m12 72% 307
Cow OR2M10 74% 312

Expression evidences

Source Accession
mRNA BC136946
GNF Atlas2 gnf1h10907_x_at
GNF Atlas2 gnf1h10908_at

Sequence information

Nucleotide sequence ATGGCATGGGAGAATCAGACCTTCAACTCTGACTTCCTCCTCCTGGGAATCTTCAATCAT
AGCCCCACCCACACCTTCCTCTTCTTTCTGGTCCTGGCCATCTTTTCAGTGGCCTTCATG
GGAAACTCCATCATGGTTCTCCTCATCTACCTGGATACCCAGCTCCACACCCCCATGTAC
TTCCTCCTCAGCCAACTGTCCCTCATGGACCTCATGCTCATCTGCACCACTGTACCCAAG
ATGGCCTTCAACTACTTGTCTGGCAGCAAGTCCATTTCTATGGCTGGCTGTGCCACACAA
ATTTTCTTCTATATATCATTGCTTGGCTCCGAATGCTTTCTGTTGGCTGTTATGTCTTAT
GACCGCTACACTGCCATTTGCCACCCTCTAAGATACACCAATCTCATGAGACCCAAAATT
TGTGGACTTATGACTGCCTTCTCCTGGATCCTGGGCTCTACAGATGGAATCATTGATGCT
GTAGCGACATTTTCCTTCTCCTACTGTGGGTCTCGGGAAATAGCCCACTTCTGCTGTGAC
TTCCCTTCCCTACTAATCCTCTCATGCAATGACACATCAATATTTGAAGAGGTTATTTTC
ATCTGCTGTATAGTAATGCTTGTTTTCCCTGTTGCAATCATCATCACTTCCTATGCTCGA
GTTATTCTGGCTGTCATTCACATGGGATCTGGAGAGGGACGTCGCAAAGCTTTTACTACT
TGTTCCTCTCACCTCATGGTGGTGGGAATGTACTATGGAGCAGGTTTGTTCATGTGCATT
CAGCCCACATCTCATCATTCTCCTATGCAGGACAAGATGGTGTCTGTATTCTACACCATC
GTCACTCCCATGCTGAATCCTCTCATTTATAGCCTCCGCAACAAGGAAGTGACCAGAGCA
TTAATGAAAATCTTAGGAAAGGGCAAGTCTGGAGAT
Conceptual translation MAWENQTFNSDFLLLGIFNHSPTHTFLFFLVLAIFSVAFMGNSIMVLLIYLDTQLHTPMY
FLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYISLLGSECFLLAVMSY
DRYTAICHPLRYTNLMRPKICGLMTAFSWILGSTDGIIDAVATFSFSYCGSREIAHFCCD
FPSLLILSCNDTSIFEEVIFICCIVMLVFPVAIIITSYARVILAVIHMGSGEGRRKAFTT
CSSHLMVVGMYYGAGLFMCIQPTSHHSPMQDKMVSVFYTIVTPMLNPLIYSLRNKEVTRA
LMKILGKGKSGD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/C D/E 1000GP (YRI, YRI, YRI)
1 100 -100 SYN G/A I/I 1000GP (YRI)
1 248,323,714 248,323,714 SYN C/T L/L 1000GP (CEU, CHBJPT)
1 248,323,932 248,323,932 NS T/C I/V 1000GP (CEU)
1 248,324,336 248,324,336 NS A/G V/A 1000GP (CEU, CHBJPT)
1 248,465,273 248,465,273 large insertion 25914bp insertion rs72482062 (DbSNP)
1 248,486,955 248,486,955 NS C/T G/R rs11589743 (DbSNP)
1 248,487,016 248,487,016 SYN C/T L/L rs4451579 (DbSNP)
1 248,487,031 248,487,031 SYN G/A I/I rs62000404 (DbSNP)
1 248,487,044 248,487,044 NS G/A A/V rs62000401 (DbSNP)
1 248,487,168 248,487,168 NS A/G C/R rs55956377 (DbSNP)
1 248,487,186 248,487,186 NS C/G G/R rs74153159 (DbSNP)
1 248,487,300 248,487,300 NS C/T D/N rs4916129 (DbSNP)
1 248,487,338 248,487,338 NS A/C F/C rs4916130 (DbSNP)
1 248,487,560 248,487,560 NS C/T C/Y rs41304034 (DbSNP)
1 248,487,638 248,487,638 NS A/G V/A rs7555310 (DbSNP)
1 248,487,701 248,487,701 NS A/G I/T rs41304036 (DbSNP)
1 248,487,764 248,487,764 NS G/A S/L rs61999307 (DbSNP)
1 248,487,768 248,487,768 NS A/G F/L rs7555424 (DbSNP)
1 248,487,834 248,487,834 NS T/G I/L rs62000388 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,319,780 248,490,372 CopyNumber Variation_31702 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D271E R235C G229R V211F D191N C169Y L143R V78A T57I S36L F35L L13I % Freq CORP
1 D R G V N C L A T S L L 36.87 0.285
2 D R G V D C L A T S L L 33.33 0.285
3 D R G V D C L V T S F L 22.12 0.103
4 D R G V D C L V T L F I 2.61 0.103
5 E R G V D C L A T S L L 1.46 0.285
6 D R G V D C L A T S F L 0.69 0.103
7 D R R V N C L A T S L L 0.61 0.285
8 D R G V D Y L A T S L L 0.38 0.285
9 D R G V N C L V T S L L 0.38 0.285
10 D R G V D C L V T S L I 0.31 0.285
11 D R G F D C L A T S L L 0.23 0.285
12 D R G V D C L V T S L L 0.23 0.285
13 D R G V N C R A T S L L 0.15 0.285
14 D R G V D C L A I S L L 0.15 0.285
15 D R G V D C R A T S L L 0.15 0.285
16 D R G V N C L A I S L L 0.08 0.285
17 D C G V D C L V T S F L 0.08 0.103
18 D R G V N C L V T S F L 0.08 0.103
19 D R G V D Y L V T S F L 0.08 0.103

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2M7.aApr07-unspliced main_exon 3UTR chr1 248,323,630 248,323,633 -
CDS chr1 248,323,633 248,324,568 -