Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2P1P Olfactory Receptor

Gene Symbol OR2P1P1 (View this gene in GeneCards)
Family 2
Subfamily P
Pseudogene Yes
CORP pseudogene probability score
Aliases hs6M1-26, AL035402-A, dJ88J8.2, HsOR6.3.3P, ORL3150
External Ids HGNC: 8272   GeneBank: NG_004693   ORDB: ORL3150   
Build #39 labels OR2P1P
Chromosomal location 6:29,071,832-29,072,566 (-)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B11 49.15% 234
OR2B2 47.98% 198
OR2C1 47.01% 234

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B11 51% 232
Mouse Or2b11 52% 232
Rat Or2b11 51% 232
Cow OR2P2 72% 208
Orang OR2G6 50% 200
Horse OR2P2 59% 300
Chimp OR2B11 49% 235

Sequence information

Nucleotide sequence TTCATTCTCTGGGGTTTCTTTGACCACCCCTAGCCGGAAATGTTTCTCTTCATAATGGGG
CTTGTTGCTTATCTCTGCATACTGGTGGACAACATCTCAATTATTGTGGTACCCAGGGGA
TATTTTAGGGGAGCACCAAATGCATCATTTTAGCTGTGACGTCTTTGGATCCTTACATTG
CCATCTGCAAACACTTGAGGTACCCAGCTATCATGCATCAGCAACTCTGTGTCCTCCTAG
TGGCCATGGCATGGCTAAGCAGTTTGGCCAACTCTACTTCAGTCATCCCTTGCCGTCCAG
CTGCCACTAGGCGGTAACAAGGTGGACGACTTTCTGTGTGAGGTCTCAGCGATGATCAAG
ATATCACGTTTTGACACCACATTCAATGTATCTATGCTCTCCATTGTGAGGATATTTTAG
TCCCTCGTTCTCTAATCAATTATCTTTGCTTACTGTGGATTCATTGTAGCTACTGTGCTG
AGGATTCAGTCCTCAGGGGGAAAGAAGGAGGTCTTCAACACATGTGGTTCTCATATTGTA
TCTCTCCTCTATGGGCCTGTAATTAGCATGTATGTACAGCCCTCTGCCAACTCCCAGGAC
AAAAACAAATTCATGTCCCTGTTCTACAGTTTGGTGACTCCTATGCTTAACCCTTTTATC
TACACTTTGAGCAACAGGGACATAAAAGGGGCAATGAGGAGGCTTCTTGTCTTTTTGTAT
CACCAGGAAGAGAAC
Conceptual translation FILWGFFDHPXEMFLFIMGLV/LSLHTGGQHLNYCGTQGIFXSTKCIILAVTSLDPY
IAICKHLRYPAIMHQQLCVLLVAMAWLSSLANS\QSSLAVQLPLGGNKVDDFLCEVSAM
IKISRFDTTFNVSMLSIVRIFXLVLXIIFAYCGFIVATVLRIQSSGGKKEVFNTCGSH
IVSLLYGPVISMYVQPSANSQDKNKFMSLFYSLVTPMLNPFIYTLSNRDIKGAMRRLLVF
LYHQEEN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP T/G 1000GP (YRI, YRI, YRI, YRI)
6 29,039,779 29,039,779 SNP G/T rs62407619 (DbSNP)
6 29,039,895 29,039,895 SNP A/G rs6456895 (DbSNP)
6 29,039,977 29,039,977 SNP A/G rs3131083 (DbSNP)
6 29,040,159 29,040,159 SNP A/G rs72863513 (DbSNP)
6 29,040,269 29,040,269 SNP C/G rs12374614 (DbSNP)
6 29,072,002 29,072,002 SNP T/G 1000GP (CEU, CHBJPT)
6 29,072,118 29,072,118 SNP G/A 1000GP (CEU, CHBJPT)
6 29,072,200 29,072,200 SNP G/A 1000GP (CEU, CHBJPT)
6 29,072,382 29,072,382 SNP G/A 1000GP (CEU, CHBJPT)
6 29,072,389 29,072,389 SNP A/G 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.