Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2S2 Olfactory Receptor

Gene Symbol OR2S21 (View this gene in GeneCards)
Family 2
Subfamily S
Pseudogene No
CORP pseudogene probability score
Aliases OST715, OR9-3, HsOR9.1.3, ORL3240
External Ids HGNC: 8276   GeneBank: AF399601, BK004443, NM_019897   ORDB: ORL3240   
Build #39 labels OR2S2
Chromosomal location 9:35,957,142-35,958,098 (-)
Cluster 9@36
Synteny CLIC#17
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs2233563)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13C6P 80.88% 319
OR13C7P 82.7% 318
OR2S1P 79.62% 319

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13C7F 83% 319
Dog OR2S2B 84% 319
Dog OR13C7I 83% 312
Dog OR2S2C 84% 319
Dog OR2S2 84% 319
Dog OR13C7G 82% 319
Dog OR13C7H 80% 317
Dog OR13C7 81% 319
Chimp CONTIG247.282-31688 97% 319
Mouse Or13c7 82% 319
Mouse Or13c7b 81% 319
Mouse Or13c7d 81% 317
Mouse Or13c7c 81% 318
Rat Or13c7e 85% 312
Rat Or13c7 83% 319
Rat Or13c7d 82% 317
Rat Or13c7c 82% 319
Cow OR2S2 87% 319
Cow OR13C7L 81% 317

Expression evidences

Source Accession
mRNA BC113651
GNF Atlas2 221409_at

Sequence information

Nucleotide sequence ATGGAAAAAGCCAATGAGACCTCCCCTGTGATGGGGTTCGTTCTCCTGAGGCTCTCTGCC
CACCCAGAGCTGGAAAAGACATTCTTCGTGCTCATCCTGCTGATGTACCTCGTGATCCTG
CTGGGCAATGGGGTCCTCATCCTGGTGACCATCCTTGACTCCCGCCTGCACACGCCCATG
TACTTCTTCCTAGGGAACCTCTCCTTCCTGGACATCTGCTTCACTACCTCCTCAGTCCCA
CTGGTCCTGGACAGCTTTTTGACTCCCCAGGAAACCATCTCCTTCTCAGCCTGTGCTGTG
CAGATGGCACTCTCCTTTGCCATGGCAGGAACAGAGTGCTTGCTCCTGAGCATGATGGCA
TTTGATCGCTATGTGGCCATCTGCAACCCCCTTAGGTACTCCGTGATCATGAGCAAGGCT
GCCTACATGCCCATGGCTGCCAGCTCCTGGGCTATTGGTGGTGCTGCTTCCGTGGTACAC
ACATCCTTGGCAATTCAGCTGCCCTTCTGTGGAGACAATGTCATCAACCACTTCACCTGT
GAGATTCTGGCTGTTCTAAAGTTGGCCTGTGCTGACATTTCCATCAATGTGATCAGCATG
GAGGTGACGAATGTGATCTTCCTAGGAGTCCCGGTTCTGTTCATCTCTTTCTCCTATGTC
TTCATCATCACCACCATCCTGAGGATCCCCTCAGCTGAGGGGAGGAAAAAGGTCTTCTCC
ACCTGCTCTGCCCACCTCACCGTGGTGATCGTCTTCTACGGGACCTTATTCTTCATGTAT
GGGAAGCCTAAGTCTAAGGACTCCATGGGAGCAGACAAAGAGGATCTTTCAGACAAACTC
ATCCCCCTTTTCTATGGGGTGGTGACCCCGATGCTCAACCCCATCATCTATAGCCTGAGG
AACAAGGATGTGAAGGCTGCTGTGAGGAGACTGCTGAGACCAAAAGGCTTCACTCAG
Conceptual translation MEKANETSPVMGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM
YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMA
FDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTC
EILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFS
TCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLR
NKDVKAAVRRLLRPKGFTQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 35,957,290 35,957,289 Ins(1) -/C rs34582331 (DbSNP)
9 35,957,452 35,957,452 NS A/G I/T rs61738501 (DbSNP)
9 35,957,764 35,957,764 NS G/A T/I rs2233561 (DbSNP)
9 35,957,383 35,957,383 NS G/A A/V rs2233567 (DbSNP)
9 35,957,236 35,957,236 NS G/A A/V rs2233570 (DbSNP)
9 35,957,831 35,957,831 NS G/A P/S rs2233560 (DbSNP)
9 35,957,615 35,957,615 NS T/C T/A rs2233565 (DbSNP)
9 35,958,047 35,958,047 NS T/C R/G rs2233558 (DbSNP)
9 35,957,317 35,957,317 NS T/C Y/C rs2233569 (DbSNP)
9 35,958,008 35,958,008 NS T/C M/V rs2233559 (DbSNP)
9 35,957,728 35,957,728 NS T/C H/R rs2233563 (DbSNP)
9 35,957,669 35,957,669 NS T/C M/V rs2233564 (DbSNP)
9 35,957,577 35,957,577 SYN G/A N/N rs2233566 (DbSNP)
9 35,957,355 35,957,355 SYN G/A T/T rs2233568 (DbSNP)
9 35,957,760 35,957,760 SYN T/C E/E rs2233562 (DbSNP)
9 35,958,050 35,958,050 NS T/C R/G 1000GP (CEU, CHBJPT)
9 35,957,455 35,957,455 NS A/G I/T 1000GP (CEU)
9 35,957,358 35,957,358 SYN G/A T/T 1000GP (CEU, CHBJPT)
9 35,957,672 35,957,672 NS T/C M/V 1000GP (CEU, CHBJPT)
9 35,957,767 35,957,767 NS G/A T/I 1000GP (CHBJPT)
9 100 -100 NS A/G V/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
9 100 -100 SYN G/A T/T 1000GP (YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V277A V228A I205T T151A M133V L121R R113H P79S V20M R7G % Freq CORP
1 V V I T M L R P V R 62.14 1.000
2 V V I T V L R P V G 29.49 1.000
3 V A I A M L R S V G 3.07 1.000
4 V V I T V L H P V G 2.23 1.000
5 A V I T M L R P V R 0.92 1.000
6 V V T T V L R P V G 0.77 1.000
7 V V I T M L R P V G 0.54 1.000
8 V V I T M L R P M R 0.46 1.000
9 V V I T M R R P V R 0.15 1.000
10 V V I T M L H P V R 0.15 1.000
11 V V I T M L R S V G 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2S2.aApr07-unspliced main_exon 3UTR chr9 35,957,108 35,957,142 -
CDS chr9 35,957,142 35,958,098 -
5UTR chr9 35,958,098 35,958,154 -