Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T1 Olfactory Receptor

Gene Symbol OR2T11 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR1-25, OR1-61, HsOR1.5.39, ORL253
External Ids HGNC: 8277   GeneBank: AF399613, BK004463, NM_030904, U86215   ORDB: ORL253   
Build #39 labels OR2T1
Chromosomal location 1:248,406,148-248,407,101 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T27 71.34% 307
OR2T6 72.79% 305
OR2T7 73.93% 280

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T1 92% 318
Chimp CONTIG22980.2-650 99% 255
Mouse Or2t1 87% 314
Rat Or2t1 87% 314
Cow OR2T1 93% 318

Expression evidences

Source Accession
mRNA AB463961
GNF Atlas2 gnf1h10655_at

Sequence information

Nucleotide sequence ATGGAAGAGTACAACACATCCTCTACAGACTTCACTTTCATGGGGCTGTTCAACAGAAAG
GAAACCTCAGGTCTTATTTTTGCCATCATCTCTATCATCTTCTTCACCGCACTGATGGCC
AATGGGGTTATGATCTTCCTGATCCAAACAGATTTGCGCCTTCATACACCCATGTACTTC
CTCCTCAGCCACCTTTCCTTAATTGACATGATGTATATTTCCACTATTGTGCCTAAGATG
CTGGTTAATTACCTGCTGGATCAAAGGACCATTTCCTTTGTGGGGTGCACAGCTCAACAC
TTCCTCTACCTTACCCTTGTGGGAGCTGAATTCTTCCTGCTGGGCCTCATGGCCTATGAC
CGCTATGTGGCCATTTGCAACCCTCTGAGATACCCTGTCCTCATGAGCCGCCGGGTCTGT
TGGATGATTATAGCAGGTTCCTGGTTTGGGGGCTCTTTGGATGGCTTCCTCCTAACCCCC
ATCACCATGAGCTTTCCCTTCTGCAATTCCCGGGAGATTAACCACTTCTTCTGTGAGGCA
CCAGCAGTCCTGAAGTTGGCATGTGCAGACACAGCCCTCTACGAGACAGTGATGTATGTG
TGCTGTGTTTTGATGCTGCTGATTCCTTTCTCTGTAGTCCTTGCTTCCTATGCCCGAATC
CTGACTACAGTTCAGTGCATGAGCTCAGTGGAGGGCAGGAAGAAGGCATTTGCCACTTGC
TCATCCCACATGACTGTGGTGTCCTTGTTCTACGGGGCTGCCATGTACACCTACATGCTG
CCACATTCTTACCACAAGCCAGCCCAGGACAAAGTCCTCTCTGTGTTTTACACCATTCTC
ACACCCATGCTGAACCCCCTCATCTACAGCCTTAGAAACAAGGATGTGACTGGAGCTCTG
AAGAGGGCCTTGGGGAGGTTCAAGGGTCCTCAAAGGGTGTCAGGAGGTGTCTTT
Conceptual translation MEEYNTSSTDFTFMGLFNRKETSGLIFAIISIIFFTALMANGVMIFLIQTDLRLHTPMYF
LLSHLSLIDMMYISTIVPKMLVNYLLDQRTISFVGCTAQHFLYLTLVGAEFFLLGLMAYD
RYVAICNPLRYPVLMSRRVCWMIIAGSWFGGSLDGFLLTPITMSFPFCNSREINHFFCEA
PAVLKLACADTALYETVMYVCCVLMLLIPFSVVLASYARILTTVQCMSSVEGRKKAFATC
SSHMTVVSLFYGAAMYTYMLPHSYHKPAQDKVLSVFYTILTPMLNPLIYSLRNKDVTGAL
KRALGRFKGPQRVSGGVF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS A/G I/V 1000GP (YRI, YRI, YRI, YRI)
1 100 -100 SYN C/T Y/Y 1000GP (YRI)
1 248,569,674 248,569,674 NS A/G I/V rs41269351 (DbSNP)
1 248,570,218 248,570,218 NS C/G T/S rs61736252 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,562,168 248,571,144 CopyNumber Variation_74991 (DGV)
1 248,562,168 248,584,112 CopyNumber Variation_84991 (DGV)
1 248,566,080 248,571,442 CopyNumber Variation_34795 (DGV)
1 248,566,656 248,571,144 CopyNumber Variation_74990 (DGV), Variation_84992 (DGV)
1 248,566,656 248,584,112 CopyNumber Variation_74993 (DGV)
1 248,567,778 248,571,144 CopyNumber Variation_84988 (DGV)
1 248,568,385 248,580,311 CopyNumber Variation_34796 (DGV)
1 248,569,349 248,572,402 CopyNumber #33 (Waszak)
1 248,570,022 248,584,112 CopyNumber Variation_84993 (DGV)
1 248,570,193 248,573,234 CopyNumber Variation_34797 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I76V P132L R137H W148* S152C R171W R171Q T257S R312T % Freq CORP
1 I P R W S R R T R 92.78 0.118
2 V P R W S R R T R 2.46 0.118
3 I P R W S R R T T 1.69 0.118
4 I P R W S R R S R 0.92 0.118
5 I L R W S R R T R 0.69 0.118
6 I P R W S R Q T R 0.54 0.118
7 I L H W S R R T R 0.23 0.118
8 I P R W C R R T R 0.23 0.118
9 I P H W S R R T R 0.15 0.118
10 I P R * S R R T R 0.15 1.200
11 I P R W S W R T R 0.15 0.118

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T1.aApr07-unspliced main_exon 5UTR chr1 248,405,995 248,406,148 +
CDS chr1 248,406,148 248,407,101 +
3UTR chr1 248,407,101 248,407,104 +