Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T10 Olfactory Receptor

Gene Symbol OR2T101 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases OR1-64, HsOR1.5.46
External Ids HGNC: 19573   GeneBank: AB065616, BK004478, NM_001004693   
Build #39 labels OR2T10
Chromosomal location 1:248,592,833-248,593,768 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T29 71.57% 306
OR2T4 72.22% 306
OR2T5 71.24% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T4D 71% 314
Mouse Or2t29 66% 310
Rat Or2t47 69% 298
Cow OR2T29 73% 305
Orang OR2T4 71% 305
Horse OR2T4 71% 309
Chimp OR2T29 73% 306

Expression evidences

Source Accession
mRNA BC136940
GNF Atlas2 gnf1h10653_at

Sequence information

Nucleotide sequence ATGCGGCTGGCCAACCAGACCCTGGGTGGTGACTTTTTCCTGTTGGGAATCTTCAGCCAG
ATCTCACACCCTGGCCGCCTCTGCTTGCTTATCTTCAGTATATTTTTGATGGCTGTGTCT
TGGAATATTACATTGATACTTCTGATCCACATTGACTCCTCTCTGCATACTCCCATGTAC
TTCTTTATAAACCAGCTCTCACTCATAGACTTGACATATATTTCTGTCACTGTCCCCAAA
ATGCTGGTGAACCAGCTGGCCAAAGACAAGACCATCTCGGTCCTTGGGTGTGGCACCCAG
ATGTACTTCTACCTGCAGTTGGGAGGTGCAGAGTGCTGCCTTCTAGCCGCCATGGCCTAT
GACCGCTATGTGGCTATCTGCCATCCTCTCCGTTACTCTGTGCTCATGAGCCATAGGGTA
TGTCTCCTCCTGGCATCAGGCTGCTGGTTTGTGGGCTCAGTGGATGGCTTCATGCTCACT
CCCATCGCCATGAGCTTCCCCTTCTGCAGATCCCATGAGATTCAGCACTTCTTCTGTGAG
GTCCCTGCTGTTTTGAAGCTCTCTTGCTCAGACACCTCACTTTACAAGATTTTCATGTAC
TTGTGCTGTGTCATCATGCTCCTGATACCTGTGACGGTCATTTCAGTGTCTTACTACTAT
ATCATCCTCACCATCCATAAGATGAACTCAGTTGAGGGTCGGAAAAAGGCCTTCACCACC
TGCTCCTCCCACATTACAGTGGTCAGCCTCTTCTATGGAGCTGCTATTTACAACTACATG
CTCCCCAGCTCCTACCAAACTCCTGAGAAAGATATGATGTCATCCTTTTTCTACACTATC
CTTACACCTGTCTTGAATCCTATCATTTACAGTTTCAGGAATAAGGATGTCACAAGGGCT
TTGAAAAAAATGCTGAGCGTGCAGAAACCTCCATAT
Conceptual translation MRLANQTLGGDFFLLGIFSQISHPGRLCLLIFSIFLMAVSWNITLILLIHIDSSLHTPMY
FFINQLSLIDLTYISVTVPKMLVNQLAKDKTISVLGCGTQMYFYLQLGGAECCLLAAMAY
DRYVAICHPLRYSVLMSHRVCLLLASGCWFVGSVDGFMLTPIAMSFPFCRSHEIQHFFCE
VPAVLKLSCSDTSLYKIFMYLCCVIMLLIPVTVISVSYYYIILTIHKMNSVEGRKKAFTT
CSSHITVVSLFYGAAIYNYMLPSSYQTPEKDMMSSFFYTILTPVLNPIIYSFRNKDVTRA
LKKMLSVQKPPY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/G L/F 1000GP (YRI, YRI, YRI, YRI)
1 100 -100 SYN C/A T/T 1000GP (YRI, YRI)
1 248,593,201 248,593,201 NS A/C S/A 1000GP (CEU)
1 248,756,152 248,756,152 SYN G/A S/S rs61732538 (DbSNP)
1 248,756,167 248,756,167 NS C/G L/F rs61732484 (DbSNP)
1 248,756,272 248,756,272 NS T/G Q/H rs61998193 (DbSNP)
1 248,756,411 248,756,411 NS A/T F/Y rs28733753 (DbSNP)
1 248,756,434 248,756,434 SYN C/A T/T rs61997185 (DbSNP)
1 248,756,474 248,756,474 NS A/G M/T rs28664620 (DbSNP)
1 248,756,502 248,756,502 NS A/C S/A rs41269353 (DbSNP)
1 248,756,791 248,756,791 SYN T/C S/S rs61743160 (DbSNP)
1 248,756,835 248,756,835 NS G/A P/S rs61730924 (DbSNP)
1 248,756,994 248,756,994 NS A/G C/R rs28405936 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber, Deletion 156 (Hasin)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)
1 248,644,944 248,790,408 CopyNumber Variation_0263 (DGV)
1 248,687,510 248,865,377 CopyNumber Variation_0017 (DGV)
1 248,701,948 248,877,423 CopyNumber Variation_2056 (DGV)
1 248,703,193 248,795,305 CopyNumber Variation_75000 (DGV)
1 248,727,899 248,808,428 CopyNumber Variation_38963 (DGV)
1 248,727,928 248,796,682 CopyNumber Variation_6818 (DGV)
1 248,729,106 248,795,518 CopyNumber Variation_66541 (DGV)
1 248,732,055 248,795,305 CopyNumber Variation_74999 (DGV)
1 248,738,015 248,795,518 CopyNumber Variation_66540 (DGV)
1 248,738,074 248,795,564 CopyNumber Variation_31705 (DGV)
1 248,749,194 248,797,213 CopyNumber Variation_38068 (DGV)
1 248,749,930 248,795,305 CopyNumber Variation_74998 (DGV)
1 248,751,305 248,795,305 CopyNumber Variation_84995 (DGV)
1 248,752,680 248,765,055 CopyNumber Variation_84996 (DGV)
1 248,752,680 248,776,055 CopyNumber Variation_75001 (DGV)
1 248,752,680 248,777,430 CopyNumber Variation_84997 (DGV)
1 248,754,134 248,757,169 Deletion, CopyNumber #23 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L301F Y220F M199T S190A A117V M59V R26C % Freq CORP
1 L Y M S A M R 91.86 0.061
2 F F T S A M C 6.22 0.061
3 L Y M A A M R 0.61 0.061
4 L Y T S A M R 0.31 0.061
5 L Y M S V M R 0.23 0.061
6 F Y T S A M C 0.23 0.061
7 F F T S A V C 0.23 0.352
8 L Y M S A M C 0.15 0.061
9 F F T S A M R 0.15 0.061

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T10.aApr07-unspliced main_exon 3UTR chr1 248,592,830 248,592,833 -
CDS chr1 248,592,833 248,593,768 -