Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T27 Olfactory Receptor

Gene Symbol OR2T271 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR1-67, HsOR1.5.49
External Ids HGNC: 31252   GeneBank: AB065611, BK004474, NM_001001824   
Build #39 labels
Chromosomal location 1:248,649,934-248,650,884 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T7 98.62% 290

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T27 88% 317
Chimp CONTIG1126.51-7507 97% 317
Mouse Or2t1 69% 315
Rat Or2t1 69% 313
Cow OR2T27 90% 313

Sequence information

Nucleotide sequence ATGGAGCAGAGCAATTATTCCGTGTATGCCGACTTTATCCTTCTGGGTTTGTTCAGCAAC
GCCCGTTTCCCCTGGCTTCTCTTTGCCCTCATTCTCCTGGTCTTTTTGACCTCCATAGCC
AGCAACGTGGTCAAGATCATTCTCATCCACATAGACTCCCGCCTCCACACCCCCATGTAC
TTCCTGCTCAGCCAGCTCTCCCTCAGGGACATCCTGTATATTTCCACCATTGTGCCCAAA
ATGCTGGTCGACCAGGTGATGAGCCAGAGAGCCATTTCCTTTGCTGGATGCACTGCCCAA
CACTTCCTCTACTTGACCTTAGCAGGGGCTGAGTTCTTCCTCCTAGGACTCATGTCCTAT
GATCGCTACGTAGCCATCTGCAACCCTCTGCACTATCCTGTCCTCATGAGCCGCAAGATC
TGCTGGTTGATTGTGGCGGCAGCCTGGCTGGGAGGGTCTATCGATGGTTTCTTGCTCACC
CCCGTCACCATGCAGTTCCCCTTCTGTGCCTCTCGGGAGATCAACCACTTCTTCTGCGAG
GTGCCTGCCCTTCTGAAGCTCTCCTGCACGGACACATCAGCCTACGAGACAGCCATGTAT
GTCTGCTGTATTATGATGCTCCTCATCCCTTTCTCTGTCATCTCGGGCTCTTACACAAGA
ATTCTCATTACTGTTTATAGGATGAGCGAGGCAGAGGGGAGGGGAAAGGCTGTGGCCACC
TGCTCCTCACACATGGTGGTTGTCAGCCTCTTCTATGGGGCTGCCATGTACACATACGTG
CTGCCTCATTCTTACCACACCCCTGAGCAGGACAAAGCTGTATCTGCCTTCTACACCATC
CTTACTCCCATGCTCAATCCACTCATTTACAGCCTTAGGAACAAGGATGTCACAGGGGCC
CTACAGAAGGTTGTGGGGAGGTGTGTGTCCTCAGGAAAGGTAACCACTTTC
Conceptual translation MEQSNYSVYADFILLGLFSNARFPWLLFALILLVFLTSIASNVVKIILIHIDSRLHTPMY
FLLSQLSLRDILYISTIVPKMLVDQVMSQRAISFAGCTAQHFLYLTLAGAEFFLLGLMSY
DRYVAICNPLHYPVLMSRKICWLIVAAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCE
VPALLKLSCTDTSAYETAMYVCCIMMLLIPFSVISGSYTRILITVYRMSEAEGRGKAVAT
CSSHMVVVSLFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGA
LQKVVGRCVSSGKVTTF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS A/C L/V 1000GP (YRI)
1 100 -100 SYN A/G L/L 1000GP (YRI, YRI)
1 248,649,970 248,649,970 SYN C/A V/V 1000GP (CEU)
1 248,649,979 248,649,979 SYN C/T Q/Q 1000GP (CEU, CHBJPT)
1 248,650,526 248,650,526 NS T/C Y/C 1000GP (CEU)
1 248,650,779 248,650,779 NS A/C L/V 1000GP (CEU, CHBJPT)
1 248,813,271 248,813,271 SYN C/A V/V rs2802081 (DbSNP)
1 248,813,280 248,813,280 SYN C/T Q/Q rs72769026 (DbSNP)
1 248,813,292 248,813,292 SYN C/T T/T rs71199329 (DbSNP)
1 248,813,343 248,813,343 SYN A/G L/L rs1938148 (DbSNP)
1 248,813,827 248,813,827 NS C/T C/Y rs1782241 (DbSNP)
1 248,813,901 248,813,901 SYN A/T A/A rs71523294 (DbSNP)
1 248,814,052 248,814,052 NS A/T M/K rs28533004 (DbSNP)
1 248,814,080 248,814,080 NS A/C L/V rs1782242 (DbSNP)
1 248,814,126 248,814,126 SYN A/G N/N rs28418327 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)
1 248,687,510 248,865,377 CopyNumber Variation_0017 (DGV)
1 248,701,948 248,877,423 CopyNumber Variation_2056 (DGV)
1 248,811,235 248,814,285 Deletion, CopyNumber #306 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y226H Y218H V134D Y120C L36V % Freq CORP
1 Y Y V Y V 64.21 0.094
2 Y Y V C V 20.58 0.094
3 Y Y D C V 6.45 0.094
4 Y Y V Y L 3.15 0.094
5 Y Y D Y V 1.84 0.094
6 H Y V Y V 1.15 0.094
7 Y H V Y V 1.00 1.000
8 H Y V Y L 0.92 0.094
9 Y Y D Y L 0.23 0.094
10 Y H V C V 0.15 1.000
11 Y Y V C L 0.08 0.094
12 Y Y D C L 0.08 0.094
13 Y H V C L 0.08 1.000
14 Y H D Y V 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T27.aApr07-unspliced main_exon 3UTR chr1 248,649,931 248,649,934 -
CDS chr1 248,649,934 248,650,884 -