Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T33 Olfactory Receptor

Gene Symbol OR2T331 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.13 (functional)
Aliases OR1-56, HsOR1.5.33
External Ids HGNC: 31255   GeneBank: AB065961, BK004484, NM_001004695   
Build #39 labels
Chromosomal location 1:248,272,855-248,273,814 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T12 95.31% 320
OR2T32P 96.56% 320
OR2T8 93.59% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T15 77% 312
Chimp CONTIG1126.4-2200 95% 320
Chimp CONTIG*********** 94% 320
Mouse Or2t44 73% 316
Rat Or2t45 71% 299
Cow OR2T13 74% 312

Expression evidences

Source Accession
mRNA BC136995

Sequence information

Nucleotide sequence ATGGAGATGAGAAATACTACCCCAGATTTTATTCTCCTAGGACTCTTTAACCACACCAGA
GCCCACCAAGTCCTCTTCATGATGGTTCTGAGTATCGTTTTGACCTCCCTGTTTGGCAAT
TCCCTCATGATTCTCCTGATTCACTGGGACCACCGGCTCCACACGCCCATGTACTTCCTC
CTGAGCCAACTTTCCCTCATGGACATGATGCTGGTTTCCACCACTGTGCCCAAAATGGCG
GCTGACTACTTGACCGGAAGTAAGGCCATCTCCCGCGCTGGCTGTGGTGTGCAGATCTTC
TTCCTCCCCACACTGGGTGGTGGAGAGTGCTTCCTCTTAGCAGCCATGGCCTATGACCGC
TATGCGGCTGTCTGCCACCCACTCCGATATCCCACTCTCATGAGCTGGCAGCTGTGCCTG
AGGATGACCATGTCGTGTTGGCTCCTGGGTGCAGCTGACGGGCTCCTGCAGGCTGTTGTT
ACCCTGAGCTTCCCATATTGTGGTGCACACGAGATCGATCACTTCTTCTGCGAGACCCCC
GTGCTGGTGCGTTTGGCTTGTGCTGACACTTCAGTCTTCGAAAACGCCATGTACATCTGC
TGTGTGTTAATGCTCCTGGTCCCCTTTTCCCTCATCCTGTCCTCCTATGGTCTCATCCTC
GCTGCTGTTCTGCACATGCGCTCTACAGAAGCCCGCAAGAAGGCCTTTGCCACCTGCTCT
TCACATGTGGCTGTGGTGGGACTCTTTTATGGAGCTGCCATTTTTACCTATATGAGACCC
AAATCCCATAGGTCCACTAACCATGACAAGGTTGTGTCAGCCTTCTATACTATGTTCACC
CCTTTACTAAACCCCCTCATCTACAGTGTGAAGAACAGTGAGGTGAAGGGAGCCCTGAAA
CGGTGGCTGGGGACGTGTGTAAACATAAAACACCAGCAAAATGAGGCCCACAGGTCAAGA
Conceptual translation MEMRNTTPDFILLGLFNHTRAHQVLFMMVLSIVLTSLFGNSLMILLIHWDHRLHTPMYFL
LSQLSLMDMMLVSTTVPKMAADYLTGSKAISRAGCGVQIFFLPTLGGGECFLLAAMAYDR
YAAVCHPLRYPTLMSWQLCLRMTMSCWLLGAADGLLQAVVTLSFPYCGAHEIDHFFCETP
VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLHMRSTEARKKAFATCS
SHVAVVGLFYGAAIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVKNSEVKGALK
RWLGTCVNIKHQQNEAHRSR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/G G/A 1000GP (YRI)
1 248,273,336 248,273,336 NS A/G V/A 1000GP (CEU)
1 248,436,312 248,436,312 NS T/C N/D rs72475088 (DbSNP)
1 248,436,506 248,436,506 NS A/G M/T rs56404069 (DbSNP)
1 248,436,611 248,436,611 NS A/G V/A rs10888338 (DbSNP)
1 248,436,616 248,436,616 SYN A/G C/C rs71538179 (DbSNP)
1 248,436,695 248,436,695 NS C/T R/K rs71642437 (DbSNP)
1 248,436,805 248,436,805 SYN G/T T/T rs28399248 (DbSNP)
1 248,436,809 248,436,809 NS A/G L/P rs61832700 (DbSNP)
1 248,436,811 248,436,811 SYN C/G L/L rs61832701 (DbSNP)
1 248,437,028 248,437,028 NS A/G L/P rs74155265 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,319,780 248,490,372 CopyNumber Variation_31702 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I309L G297A A169V % Freq CORP
1 I G V 66.05 0.285
2 I G A 32.41 0.285
3 L G V 0.77 0.285
4 L G A 0.46 0.285
5 I A V 0.23 0.285
6 I A A 0.08 0.285

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T33.aApr07-unspliced main_exon 3UTR chr1 248,272,852 248,272,855 -
CDS chr1 248,272,855 248,273,814 -